KEGG   Aspergillus flavus: AFLA_058600Help
Entry
AFLA_058600       CDS       T01090                                 

Definition
(RefSeq) beta-fructofuranosidase, putative
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
afv  Aspergillus flavus
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AFLA_058600
   00500 Starch and sucrose metabolism
    AFLA_058600
Enzymes [BR:afv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AFLA_058600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
AA seq 348 aa AA seqDB search
MTIAYAQDLVIGFYTSPNLKDWTHASNFTQEGLPGDQFECPNLVKFSVDRAVSEETSKFV
LFISVNPGAPLGGSGTFYVVGDFNGTHFTSEVAQETLFDFSKDNYAAQWYSGIPENEPPV
SIGWASNWDYTEEVPTGPLEGWRSAMTLPRAHTLTKVNGVWTVTHSPFEGLSALKGRQLV
SKSVHSGDVKANFSGVPSNAVYFDVTLKGIDVAKPTGRVNFNFTSSVSGEFLDGGVSLDD
SSFWISRAGTHLFTIEDNGNYTSSSTTTISSFGNGTFSFSGVIDRSVFEVFLGQDGIQSG
TMTFFPSSPLDTLAVSAEDLGDRASVSVKAWGLQSGWNSTTASKRFRA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgactattgcctatgcgcaggacttggtcattggattttatacctcgcccaatctcaaa
gactggacgcatgcgtcgaatttcacccaggaagggctgccgggcgaccaattcgaatgc
cccaacttggtcaagttttcggtggatcgcgctgtgtctgaggagacgagcaagttcgtg
cttttcatttccgtgaaccctggcgctcctcttggaggttcgggaacattttatgtggtc
ggcgatttcaacggcacccatttcacctctgaagttgctcaggagacactttttgatttc
tccaaggacaactatgcggctcagtggtattctggtattcctgagaacgagcctcctgtc
tccatcgggtgggctagcaactgggattacaccgaagaagtccccactggcccgcttgaa
ggctggaggagcgccatgactttacctagagcgcacaccctaaccaaggtcaacggagtc
tggactgtgactcacagcccgtttgagggcctttctgctcttaagggcagacagcttgtg
agcaagagtgtccactctggggatgtgaaggcgaacttctctggggtcccatcgaatgca
gtatatttcgatgtgacactgaagggcatcgatgttgccaagcctaccggacgcgtaaac
ttcaactttacctcctctgtatcgggtgaattcctcgacggaggggtgtctctggatgat
agttctttctggatcagcagagctggaacccatcttttcacgattgaagataatggaaat
tatacatcatcttctacaacaactatctcctcctttggcaacggcacattcagcttctcg
ggcgttattgaccgctctgtgtttgaagtcttccttggtcaggacgggatccaaagcgga
accatgactttcttcccaagctccccactcgataccttggctgtttccgcagaggatctc
ggagatcgggctagcgttagtgttaaggcttggggccttcagagcggctggaactcaaca
acagccagtaagaggttccgcgcctga

DBGET integrated database retrieval system