KEGG   Aspergillus flavus: AFLA_058810Help
Entry
AFLA_058810       CDS       T01090                                 

Definition
arginase, putative
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
afv  Aspergillus flavus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AFLA_058810
Enzymes [BR:afv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AFLA_058810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 413 aa AA seqDB search
MLGPYVHKRAPAELPFSCITVSQSTMIAYGLLTLIVSTAAVAREIVFPPIAAIQGSGQVP
LGEDDTVDIVTGSHFSGLTTFGHLPYVNCLVDDQAHSTPYDIAILGAPFDTGVTARPGAR
FGPVGIRLGSRRLQGWNIYTGVNVFESWAKLVDCGDAPLTRLDNTVALKQLDLAHKVISS
RPTNSTDRGRTPRILTLGGDHTTTLSALRSTYDKWGPVSVIHFDSHLDTWDPKVLGKVMF
KPPISLAQHITDITSGVNHGTFLHIAHEEGLIRNTSLHVGIRAPVIRPKGDIRNDIRCGF
EIIKARDLDRVGINGIVDQIKARVGDSKVYISVDIDVLDPAYAPATGTAEPGGFTTRELL
SILDALHGLPVIGADVVEVAPIYDTTAETTTLAAAEVAHSLLYLMVETPVNDN
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcttggcccatacgttcataagagagcaccagctgagctcccattttcttgcatcact
gtgtcacaatccaccatgattgcctacggcctgctcactctcattgtatccacagctgcc
gtcgcgagggagatcgtcttccctcccatcgcagcaattcaaggttccggacaagttccg
ctcggtgaagatgataccgtcgatattgttacgggtagtcatttctcggggctgactacg
ttcggacacttaccttacgtaaattgcttggtggatgaccaggcacattccacgccctac
gatattgcaattttaggtgccccgttcgacactggtgttaccgctcgccccggagccaga
ttcgggccagttggtattcgtctcggctctcggcgattacaaggatggaacatctatacc
ggagtcaacgtcttcgaaagctgggcgaaattagtggattgtggggatgcgccactaacc
cggttggataatacagttgcgttgaagcagcttgatttagcacataaggttatctcatca
cgtcccacgaatagtacggaccggggccgtacacctcgtattcttactctgggtggagac
cacacaacgaccctgtcggcactgaggtcgacgtatgacaagtggggtcctgtttcggtt
attcattttgatagccatctcgatacctgggatcctaaagtactaggtaaggttatgttc
aaacccccgatatcgttggcacaacacataactgacattaccagcggtgtaaaccacgga
accttcctacacatagcccatgaagagggccttatccgcaacacatcattgcacgtcggc
atccgtgcccctgttatccgcccaaaaggcgatatccgaaatgatatccgatgtggattc
gaaatcatcaaggctcgtgacttagaccgggtcgggataaatggtatcgtcgaccagatc
aaggctcgagttggcgatagcaaggtgtatatttctgtggacattgatgtgttggaccca
gcctacgcacctgcaacgggaactgcggagccaggtggttttaccacccgcgagcttctt
tctatcttggatgctctacatggattgccggtgataggcgccgacgttgtcgaggttgcg
cctatatacgatacaacggccgagaccacgactttggctgctgctgaggtggctcattcg
ttgctttatttgatggtggaaacaccagtaaatgataactag

DBGET integrated database retrieval system