KEGG   Aspergillus flavus: AFLA_059410Help
Entry
AFLA_059410       CDS       T01090                                 

Definition
(RefSeq) lysophospholipase Plb3
  KO
K13333  lysophospholipase [EC:3.1.1.5]
Organism
afv  Aspergillus flavus
Pathway
afv00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AFLA_059410
Enzymes [BR:afv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AFLA_059410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B CHASE4
Motif
Other DBs
NCBI-GeneID: 7909567
NCBI-ProteinID: XP_002378685
UniProt: B8NDK2
AA seq 627 aa AA seqDB search
MKVALLTLAAGLANAASIAVTPRAFPNAPDKYAPANVSCPSTRPSIRSAAALSTSEKDWL
QVRRNETLEPMKDLLGRLNLSSFDASGYIDRHKNNASNIPNVAIAVSGGGYRALTNGAGA
IKAFDSRTSNSTARGQLGGLLQSSTYLSGLSGGGWLVGSVYINNFTTIGDLQASDKVWDF
KNSILEGPDVKHFQLINTAAYWKDLYDAVKDKRNAGFNTSLTDYWGRALSYQFINATTDD
GGPSYTWSSIALGDDFKKGKMPMPILVADGRNPGEILIGSNSTVYEFNPWEFGSFDPSVY
GFAPLEYLGSNFENGELPKGESCVRGFDNAGFVMGTSSSLFNQFILRLNGTDIPNFLKEA
IADVLEHLGENDEDIAVYAPNPFYKYRNSTAAYSSTPELDVVDGGEDGQNVPLHPLIQPT
RNVDVIFAVDSSADTDHSWPNGSSLIYTYERSLNTTGIANGTSFPAVPDVNTFLNLGLNK
RPTFFGCNSSNTSTPTPLIVYLPNAPYTAESNTSTFQLAYKDQQRDDIILNGYNVVTQGN
ASADANWPSCVGCAILQRSTERTNTKLPDICNTCFKNYCWDGKTNSTTPAPYEPELLMEA
STSGASKDQLNRTAAVIAFAVMFFMTI
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgccctgctcaccttagcagcgggcttggccaatgccgcctcgatcgccgtc
actccacgggcgttccccaatgcccctgataaatatgctcccgcaaatgtttcctgtccg
tcgactcgtcccagtatccgcagtgccgccgccctgtccaccagtgagaaggattggttg
caagtgcgtcggaatgagacccttgaacccatgaaggatttgctcgggcggctcaatcta
agctcctttgatgcctcggggtacattgaccgtcataaaaacaatgcatcgaatattcca
aacgtggccattgccgtttcaggtggtggttaccgcgctttgaccaatggcgcgggtgct
atcaaggcattcgatagtcgtacctccaactccacagcccgtggacagctcggaggcctt
ctgcagtcctctacttatctatcgggcctcagtggtggtggatggctcgtgggctccgtg
tacatcaacaacttcaccactatcggtgacctgcaggccagcgacaaggtctgggatttc
aagaactctattctggagggtcctgatgttaaacatttccaactgatcaacactgccgcg
tactggaaggatctgtacgatgcggtgaaggataagagaaacgccgggttcaacacttcg
ttgaccgactactggggccgtgctctctcctatcagttcatcaacgctaccactgatgat
ggcggtcccagttatacctggtcgtcgattgccttgggcgacgatttcaagaagggcaag
atgcccatgcctatcctcgtcgccgatggacgtaacccgggcgaaatacttattggaagt
aactcgactgtgtatgaatttaacccatgggagttcggctccttcgacccgtcagtatac
ggctttgcaccattggagtatcttggatccaatttcgagaacggtgaactccccaagggg
gaatcgtgcgtgcgcggctttgacaatgcgggttttgtcatgggtaccagctcttccctg
tttaaccagttcattctgcgtctgaacggcaccgatatccctaatttcctcaaggaggcg
attgccgacgtcttggaacatctgggcgaaaacgatgaggacattgcagtttacgcaccc
aaccccttctacaaatatcgcaattcaacggcagcatattcgtcaaccccagagctggac
gtggtcgacggaggtgaagatggacagaacgtgcctctacacccgttgatccagcccacc
cgcaacgtggatgtgatctttgccgtggattcgtccgctgatacggaccatagctggccc
aacggatcctccttgatctacacctatgaacgtagcttgaatactacaggtatcgccaac
gggacctccttccctgcggtgcccgacgtcaacacgttcctcaaccttggcctgaacaaa
cgcccgaccttcttcggatgcaattcatccaacaccagcaccccgaccccattgattgtc
tacttgcccaacgccccttacaccgccgagtccaacacgtcgaccttccagctggcgtat
aaggaccaacaacgcgatgatattatcttgaacggctacaatgtcgtcacccagggcaat
gccagtgccgacgcaaactggccctcgtgcgttgggtgcgctattctccagcggtccacc
gaacgtacgaacactaagcttcccgatatctgcaatacctgcttcaagaattactgctgg
gacggaaagaccaacagcaccacaccggccccctatgaaccggagctgttgatggaggcg
tcgacttccggggcctcgaaggatcaactgaaccggacagctgcggtcatcgcgttcgca
gttatgttctttatgacgatctag

DBGET integrated database retrieval system