KEGG   Aspergillus flavus: AFLA_062530Help
Entry
AFLA_062530       CDS       T01090                                 

Definition
(RefSeq) protein kinase, putative
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
afv  Aspergillus flavus
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:afv00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AFLA_062530
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AFLA_062530
Protein kinases [BR:afv01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   AFLA_062530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1228 aa AA seqDB search
MSRRLRSNSIRRKSVTISNPPSDSVPSRPPTLATATRSRRQSLAQPSNASSAAPRTSRKS
IGQGSIPSARRQSLSSRKASADASHNLLHPRTQNLESMPNDATRLPTSARNIKAKSLQPP
SREPREAFLTTSGSADHSRSSSTNAVRTPVKNAQAPLTTPSSTSKRVSVMPPHATGLGAR
TISPTDARRLKRMSTAPQAPPLPYTPPTQTDSLPVRPRSCAQSPSYIPRKSVTPSSNRTT
PDPSRKSYSSGLSLSSTTSHNSARNSGGSLQTRLAQAASSSRLPTPKPRVEHTVPADEEV
PPVPAIPKAYESPKGEPEQPNCTAPRKSHIPVDIAVLKGKSDTESDTNPTASATEDDTMD
LPAKRALKTPEAKHKPTASLGRRNLQPLKLPPLNLLPLGTPMTNKIQAMKDREEDAKSHT
PTGQVVAKTPSTPLTASKANFFAVEDDAVPRTQARSSTAHFVVSTSSGATLRTASSSSAL
ASFENTSVGARTNSPYVSYSLPKSNSDVNNLRQKASADYSSRVSQSHKLTGPRPQTQSSA
FSSNAETISQISTPSDPDNNSTSGSSFMNKITITRHRSNSRPQQVTDANTDPTKLEPMPP
PKLPASATWNNLSTAKNTSPTLKPSYFKSKRQVSVSNAAASPIRKPSFSSEQSLSLEHSI
SNESRHSDAPSHRSASSILSPVHRILNSAKSNAAMNSTSSDPNVDPDIQIADDEMRKLNG
RRKDFENAAKELDELRRKAGPKERVSPAQALKMANLNIFERGEIIDFKDIFFCGTQHAKK
HVGDLNAQAANFGYDDDRGDYNIVIGDHLAYRYEVIDVLGKGSFGQVLRCVDHKTGGLVA
VKIIRNKKRFHQQALIEVNLLQKLKEWDPHRRHSVVNFTQSFYFRGHLCISTELLGMNLY
EFIKAHDFKGFSVKLIRRFTKQILSTLVLLHTKKVIHCDLKPENILLVHPMSSEIRVIDF
GSSCFENEKVYTYIQSRFYRSPEVILGMSYGMPIDMWSLGCILAELYTGYPIFPGENEQE
QLACIMEVFGPPEKHLIEKSTRKKLFFDSLGKPRLTVSSKGRRRRPSSKELRQVLKCDDE
AFLDFISRCLRWDPSRRLSPHDALRHEFLTGLKMPSRSRTYTASLNSPAKRGNTLSTPSS
GRPLPEPPGTSLKHGTFLRSRDVSGSSPVKPIAGKRHSTVSGVQPSTPKRSTTTSTTTPG
SALPRVAGRSISGKPDLATAAAATSLVS
NT seq 3687 nt NT seq  +upstreamnt  +downstreamnt
atgtctagacggttgaggagcaactctatcaggaggaaaagtgtgaccattagcaaccct
ccgagcgactcagtaccatcccggccgccgacattggctacagctactcggagtcgccgt
caaagtctcgcccaaccgtcaaatgcaagcagcgctgctccacgaacttcgcgtaaatcg
ataggacaaggttcgattccgtctgcgaggcgacaaagcttgtcgagtaggaaggctagt
gccgacgcaagccacaacttgctgcatccacgcacgcaaaatctagaatctatgccaaac
gatgcaacgagactaccaaccagtgcgcgaaatatcaaggctaaatccctacagcctccg
tcaagggaacctcgcgaagcctttctgacgacctctggatctgcggatcattccagatct
tcgtcaaccaatgccgtccgaacgccagtcaagaatgcacaagcaccgcttacgacccca
tcatctacatcaaaaagggtttctgtaatgcccccgcacgcgacaggcttaggggctcgt
actataagtccgacggatgcacgacggctgaagcgtatgtcaacggcacctcaggcgcct
cctttgccttatactcctccgactcagaccgattcattacctgtccgtcctcgctcatgc
gcccagtcgccgtcttacatccctcggaagagtgtgacaccttcctccaacagaactacc
ccggatccttcccgtaaatcctatagctctgggttatctttgtcgtcgaccacgagtcat
aactcggcaaggaattccgggggttcattacaaacccggcttgctcaggctgcatcatct
tctaggctccctacgcctaaacctcgtgtagagcacactgtgccagcagacgaggaagtc
cctcctgttcctgctattcctaaagcctacgagtctccgaaaggggagcctgagcaacca
aattgcacagctcctcgcaaatcgcacattccggtggatattgctgttttgaaaggcaaa
tcggacacggagtcggacacaaaccctacagctagtgcaacagaagatgatacaatggat
ctacccgccaaacgagcattgaagactccagaagccaagcacaaaccaactgctagcttg
ggcagaaggaaccttcagccgctgaaattgccgccgttgaatctgttgcctttgggtaca
ccaatgactaacaagatccaagccatgaaagaccgagaggaggatgcgaaatcacatacg
ccaacgggtcaggttgtcgcgaagactccaagtacccctcttactgcctcgaaagctaat
ttcttcgctgtcgaagacgacgctgtaccacgcacacaagcgaggagcagcaccgcacat
tttgttgtgagtacgtcttcgggtgctaccttgaggacagccagcagctccagcgcatta
gcatctttcgaaaacacatcagttggtgcaaggacaaattcgccttatgtctcgtactcg
ctccctaagagcaacagtgatgttaataatctccgccaaaaggctagtgcagattactct
tccagagtgtcacagtctcacaagttgacgggtccacgtcctcaaactcaatcatctgct
ttctcttccaatgcagaaacaatcagtcagatctctaccccgtctgatcccgacaacaac
agcacttctgggtcctctttcatgaataagatcacgataacccgccacaggagcaattct
cgacctcagcaggtaacggacgcaaatacagaccccactaaactcgagcccatgccgcca
cctaagcttccagcgtctgcaacctggaataacctatcaacggcgaagaatacaagtccc
acgctaaagccaagctatttcaagtcaaagcgacaggtctctgtatcaaacgcggcagcc
tcgccaatacggaaacccagtttcagtagcgaacagagtctttctttagaacacagcatt
tcgaacgagtcgcgtcatagtgatgccccatcccaccgttctgcatcatcgatcctctcc
ccagttcacagaatactcaactctgcgaagtcgaacgctgccatgaactccacttcttcc
gatccaaacgttgaccccgatatccaaatcgctgacgacgagatgcggaaacttaatggc
aggcgaaaagatttcgaaaacgcggcgaaagagttagatgaactgcgccgcaaagctggg
ccgaaggagcgtgtcagcccagctcaggctctcaaaatggcaaatctgaatatctttgag
cgtggtgaaattattgacttcaaagatatctttttctgcggaacccaacatgcaaagaaa
catgtcggagacttgaatgcacaagccgctaactttggctacgatgatgatcgcggtgat
tacaatattgtcattggggaccacttagcctacagatacgaagtcatcgacgttctgggc
aagggaagctttggtcaagttctaagatgtgttgatcacaaaacgggcgggttggttgct
gtgaaaatcatccgcaacaagaagaggttccaccagcaagccttgattgaggttaatctg
cttcaaaagctcaaagagtgggatcctcatcgtcggcatagcgttgtcaatttcacccaa
agcttctacttcaggggacacctctgcatatctacagaactgctgggaatgaacttatat
gagttcatcaaagcccatgacttcaaaggattctctgtcaaactcattcgccgttttacg
aaacagattttgagtacgctggtgcttctccacaccaaaaaagtcatccactgcgatctc
aagccggagaacattctccttgtacacccaatgagttccgagatcagagtcatcgacttt
ggctctagctgcttcgagaacgagaaggtctatacctatatccagagtcgcttttatcgc
tcaccagaagtcattcttggcatgtcatacggcatgcccattgacatgtggagtctagga
tgtatcctggctgagctgtacacgggatatcccatcttcccgggagagaatgaacaagag
cagcttgcctgtatcatggaggttttcgggcctccagagaaacacttgatcgagaagagt
acacggaagaagctcttctttgattccttgggcaaaccgagattaacggtctcctcaaaa
ggtcgacgtcggcgtccaagttcgaaggagctcaggcaggtcctgaaatgcgacgacgag
gctttcctcgacttcatctcccgctgccttcgttgggacccgtcccgccgtcttagcccg
cacgatgccctcaggcatgaattcctaacagggctcaaaatgccctcgcggtctaggaca
tatacagcgagcttgaattccccggccaagcgggggaatactctatcaaccccgtcgtca
gggcgccctcttccagaaccacctggcacgagtctcaagcatggcacctttctgcgtagc
cgagatgtctcaggtagctctccagtcaagccaatagccgggaagcgccactcaactgtg
agtggtgtccaaccgtccacccccaagcgaagtacaactacttctacaacgactcctggg
tcagcattgcctcgcgttgctggtaggagcatcagtggaaaaccagacctcgcaacagcg
gcggctgcgaccagcctggtgagttga

DBGET integrated database retrieval system