KEGG   Aspergillus flavus: AFLA_067060Help
Entry
AFLA_067060       CDS       T01090                                 

Definition
(RefSeq) NADH-ubiquinone oxidoreductase 19 kDa subunit, putative
  KO
K03952  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8
Organism
afv  Aspergillus flavus
Pathway
afv00190  Oxidative phosphorylation
afv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    AFLA_067060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHCH CX9C Cmc1
Motif
Other DBs
NCBI-GeneID: 7919113
NCBI-ProteinID: XP_002380265
UniProt: B8NJI5
Position
Unknown
AA seq 159 aa AA seqDB search
MAAREPQFNQQVLVDTTPMPADIPSVQEVGATSAPLTSAAYFIGDRCKAFNDDYMKCKQE
ANGRGEFDCLKEGRKVTRCAASVIKDINTHCLKQFTAHWECLENNNHHLWECRKPEMELN
KCVFDKLGLKKTIPGAPEGQTPVHLRPKQIYAQFPGPQY
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccgagaacctcagttcaaccaacaggtcctggtggacaccacgcccatgccg
gcggacattcccagtgtccaggaagtcggcgcgacctcggcacccctgaccagtgcggcg
tactttatcggcgacaggtgcaaggccttcaatgatgactacatgaagtgcaagcaggag
gccaatggaaggggggagttcgattgtctgaaggagggacggaaggtgacgagatgtgct
gcttctgttatcaaagatatcaacacccactgcctgaaacaattcaccgcgcactgggag
tgtcttgagaacaacaaccaccatctgtgggagtgccggaagcccgagatggagctgaat
aagtgtgtctttgacaagctgggcctcaagaagacgatccccggcgcccccgagggccag
accccggttcatctgcgtcccaagcagatttatgctcagttccctggtcctcagtattag

DBGET integrated database retrieval system