KEGG   Aspergillus flavus: AFLA_068470Help
Entry
AFLA_068470       CDS       T01090                                 

Definition
histone-lysine N-methyltransferase Clr4
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
afv  Aspergillus flavus
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AFLA_068470
Enzymes [BR:afv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AFLA_068470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 502 aa AA seqDB search
MPVKMVIDLTGDSDSEDQIRSQLHSNIQSATPTFFTHLAHRTPSSSVPLKRKSERSPESE
LYDSFFNFKRKPSAPSVESSAASSSVPHQNNLPNGSTIATTKLQSSTPSPSPVIKEQSLP
ARAISVVVPSPSSQLKKEIESAKWASSSQSCTPELKGVLEKFYPTNAHVERGRKGAYPAA
RKVNRAAIPLPTGTPGPILQKRPEALDQQYRTLERKLSTIKGPKITFAPADGPKLAKVTA
NFQFINSYKLHKGVSPAPAEFIGGCSCGKHCDPERCPCSEKEDDSTENIIPYQRAKDRPD
LLVLTPEFLRRTAMIFECGAQCACDKSCWNRVVQRGRTVELEIFYTGNRGFGLRSPRYIR
EGQFIDCYLGEVITKQHADIREETAVKNGHSYLFGLDFSPEVDEEDIYVVDGQRFGCATR
FMNHSCKPNCRMFTVTNTIGDERLYNLAFFALKDIPPMTELTFDYNPGTERSEKVDSSVV
ACLCGEDNCRGQLWPSKRKGTK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcaagatggttatcgatttgacaggagattctgattctgaagaccagatccgc
tcgcagctgcactcaaacattcagtcggctacacccacttttttcacccacttagcacat
cggacaccgtcatcgtctgtccctttaaagagaaagtcggagagaagtccagagtcagag
ctatatgattcttttttcaacttcaagagaaagccttctgcgccctcagtggaatcctct
gcggcttcaagttctgtcccccatcagaacaatctgccgaatggcagtaccatagctact
acaaagctccaatctagcacccctagcccgagtccggtcattaaggagcagagtctgccg
gcacgggccatcagtgttgtagtcccttctccatcgtcacagctgaagaaggaaattgag
tctgccaagtgggcatcaagctctcaaagttgtacccctgagctgaagggagtcctggag
aaattctatccaactaacgcacatgtagagcgcggtcgcaagggtgcttatccagcagcg
aggaaagtcaaccgtgctgcaatccctctgcctactggcacacccgggcccatcttacag
aagagaccagaggcccttgaccagcaataccgtactctggaacgcaagctttctacgatc
aagggacctaagatcacgtttgcgccagctgatggaccaaagctcgcaaaggtgaccgct
aattttcagttcattaatagctataaacttcacaaaggggtttcccctgctccagctgaa
ttcattggaggctgcagctgtggtaaacactgtgatcctgagaggtgcccctgctctgaa
aaggaggatgattcaactgagaacatcattccgtaccaaagagctaaggaccgcccagac
ctgctagtcctgactccagaattcctgaggcgcaccgcaatgattttcgaatgtggtgcg
cagtgtgcctgcgataagagctgttggaatcgggttgttcagcgtggcaggactgtggaa
ttggaaattttctatactggcaatcgtggctttggcctccggtctcctagatacatcaga
gagggccagtttatcgactgctacctaggagaagttattaccaaacaacacgcagatatt
cgcgaagagaccgccgtgaaaaatggccattcctatctctttggactcgacttctctccc
gaagttgatgaagaagacatctacgtcgtcgatggacagaggttcggctgcgcaactcgt
ttcatgaaccactcctgcaaaccaaactgccggatgttcaccgtcacaaacaccatcgga
gacgagcgtctctataacctggctttcttcgccttgaaagatatcccaccgatgaccgaa
ttgacgtttgattacaaccctggcacagagagaagcgaaaaagtcgactctagtgtcgtc
gcttgcctgtgtggagaggataactgtcgaggtcaactctggccgagcaaacgcaagggc
accaaataa

DBGET integrated database retrieval system