KEGG   Aspergillus flavus: AFLA_068540Help
Entry
AFLA_068540       CDS       T01090                                 

Definition
sphingosine kinase (SphK), putative
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
afv  Aspergillus flavus
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AFLA_068540
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     AFLA_068540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 502 aa AA seqDB search
MTSPSNGPSSNHADQPDSQRLLQHDSTLTVAQSVSLSIGGDSLLVVDERPKSKDQRACCG
LLAKSSKTTHSIGLYNILDADLSPAGLTITYAQAATKGSISVAALEYPISEKEKANAQTW
VSRLLDLAYGEAQRYKRLKVLINPFGGKGAASKIYHKHAAPVFAAARCVVDVQQTTHRGH
ATEIVEQIDIDAYDAIVCCSGDGLPYEVFNGLGKKPNAGEALAKVAVAMVPCGSGNAMAW
NLCGTGNVSVAALAIVKGLRTPMDLVSLTQGNTRTLSFLSQSFGVIAESDLGTDNIRWMG
AHRFTYGFLVRIMQRTVYPCDLAIKVEIDDKRAIKDHYNTYAHNPAPRRSPEETAGQSKG
LPELRYGTVQDDLPKDWEVVPGEEMGNFYAGKMAIVSKDTNFFPASVPNDGLMDIVTING
TLPRTTTLKMMTAIPENEFFDMPDVKIRKAAAYRLVPRQKEGYISVDGESIPFEALQAEV
HKGLGTVLSKSGHLYEAEGPRP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacttctccctccaatggcccttcttccaatcatgcggatcagccggattctcaacga
ttgctgcagcacgattcaaccttaacggttgcacaatcggtttctctttccatcgggggt
gactcccttctcgttgtcgacgagcgcccaaagtcaaaagatcagcgcgcatgctgtggc
ttgttggccaagtcatctaaaactacccattccattgggctatataatattcttgatgcc
gatctttcccctgcgggcctaactatcacctatgcccaagccgctaccaaaggcagcatc
tctgtggctgcccttgagtacccgatcagtgagaaagaaaaggcaaatgcgcagacgtgg
gtttcgcgactgttagaccttgcatatggcgaagcacaacggtataagagacttaaagtt
ttaatcaacccatttggcggtaaaggtgcagcttctaagatctatcacaaacatgcagca
ccggtcttcgccgctgcgcgctgtgtggttgatgtgcagcaaacaacacatcgaggccac
gccaccgagatcgtggagcagatcgacatcgatgcctatgatgctatcgtttgctgttcc
ggtgatggtttaccgtatgaggtcttcaatggtctcggaaagaaaccgaatgctggagaa
gcactggcaaaagtagccgtcgccatggttccctgcggctctggtaatgccatggcatgg
aacctttgtgggacgggcaatgtttcagtggcagcgcttgcgattgtcaaaggcttgaga
acgcctatggatctggtctcgcttacgcaagggaacactcggactttgtcgttcctgtct
caatccttcggtgtcatcgcggaatcggaccttggaaccgacaacatccgatggatgggg
gctcaccgtttcacgtacggtttccttgtacgcatcatgcaacggacggtgtacccatgc
gacctcgccatcaaagtggagattgatgataaaagagcgatcaaagaccattacaataca
tacgcacacaacccagctccgcgccgttcccccgaagagactgcaggacagtccaagggt
cttcccgagcttagatacggcacggtccaggatgatcttcccaaagattgggaagttgtt
ccaggagaagaaatgggcaacttttacgcaggcaaaatggctattgtatccaaggacaca
aatttcttccctgcctccgtgcccaacgatgggttaatggacattgtcactatcaacgga
acacttccccgtactacgaccctcaagatgatgactgccatccctgagaatgagttcttt
gatatgcccgatgtcaagatccgcaaagctgctgcctaccgcctggtccctcgtcagaag
gaaggttatatcagcgtcgacggtgaaagcatcccgttcgaagctctccaggctgaagtc
cataaaggtctcggtacagtgctttctaaatcgggacatctttatgaggcagagggcccg
agaccgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system