KEGG   Aspergillus flavus: AFLA_070990Help
Entry
AFLA_070990       CDS       T01090                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase Ugp1, putative
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
afv  Aspergillus flavus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AFLA_070990
   00052 Galactose metabolism
    AFLA_070990
   00500 Starch and sucrose metabolism
    AFLA_070990
   00520 Amino sugar and nucleotide sugar metabolism
    AFLA_070990
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AFLA_070990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 502 aa AA seqDB search
MSWFKTCMLTGRFPQAFENASTSVAASQMRNALNALSETVPDPQERKRFEAEMDNFFALF
RRFLNDKAKGNEVNWDRIAPPQPSQVVNYESLGSEASVEFLNKLAVVKLNGGLGTSMGCV
GPKSVIEVREGMSFLDLSVRQIEHLNRTFNVNVPFVLMNSFNTDQDTQSIIKKYQGHNVD
ILTFNQSRYPRIIKDSLLPAPKSFDAPLQDWYPPGHGDVFESLYNSGTLDKLLERGVEYI
FLSNADNLGAVVDLRILQHMVDTESEYIMELTDKTKADVKGGTIIDYEGKARLLEIAQVP
KEHVNEFKSIKKFKYFNTNNIWMSLRAIKRVVEENELEMEIIANEKSIPADKKGDADQAI
YQLETAVGAAIRHFKNGHGVNVPRRRFLPVKTCSDLLLVKSDLYRLEHGQLVMDPNRFGG
VPVIKLGSDFKKVSDFQKHIPSIPRIVELDHLTITGAVNLGRNVTLKGTVIIVATEGSTI
DVPPGSVLENCVVQGSLRILEH
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtttaagacttgcatgctaacaggccgattccctcaggcgttcgagaatgca
tcgaccagcgttgctgcttctcagatgcgtaatgctctgaatgccctctcagagaccgtc
cctgatcctcaggagcgcaagcgcttcgaggctgagatggacaacttcttcgccctcttc
cgcagatttctgaacgacaaggctaagggcaacgaagtgaactgggaccgcattgctcca
ccccagccttcccaggtcgttaactatgagagcttgggcagcgaggcctcggttgagttc
ctgaacaagttggctgttgttaagctgaacggtggcttgggtacttccatgggttgcgtt
ggccccaagtcagtcattgaggtccgtgagggtatgtccttcctggatctgtccgttcgc
cagatcgagcacctgaaccgcactttcaacgtcaacgttcccttcgtcctgatgaactcc
ttcaacaccgaccaggacactcagtccatcatcaagaaataccagggccacaacgttgat
atccttaccttcaaccagtctcgctacccccgtatcatcaaggactctcttctccccgct
cctaagagctttgatgcacctttgcaggactggtatcccccaggccatggtgatgtcttt
gagtccctgtacaactctggcactcttgacaagctcttggagcgtggtgtggagtacatc
ttcctgtccaacgccgacaacttgggtgctgtggtcgaccttcgcatcttgcagcacatg
gttgataccgagtctgagtacatcatggaattgactgataagaccaaggccgatgtgaag
ggtggtactatcatcgactacgagggcaaggctcgtctcttggaaatcgctcaggttcct
aaggagcacgtcaacgagttcaagtctatcaagaagttcaagtacttcaacacgaacaac
atctggatgagtctccgcgctatcaagcgtgttgttgaggagaacgagcttgagatggag
atcatcgccaacgagaagtcgatccccgctgacaagaagggtgacgccgaccaggccatt
tatcagcttgagaccgctgttggtgccgctatccgtcacttcaagaacggccacggtgtg
aatgtccctcgtcgccgcttcctgcccgtgaagacatgctccgatctcttgctggtcaag
tcggatctttaccgtctggagcacggtcagttggtcatggaccctaaccgcttcggtggt
gttcctgtgatcaagcttggatccgatttcaagaaggtttcggatttccagaagcacatc
cccagcatcccccgtatcgttgagctcgaccacctgacgatcaccggtgccgtcaacctg
ggtcgcaatgttactctgaagggcacagtcatcattgtcgccacggagggtagcaccatc
gatgtgcctcctggatcggtactggagaactgtgttgtccagggaagcttgcgtatcctg
gagcattaa

DBGET integrated database retrieval system