KEGG   Aspergillus flavus: AFLA_073260Help
Entry
AFLA_073260       CDS       T01090                                 

Definition
(RefSeq) hexokinase, putative
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
afv  Aspergillus flavus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFLA_073260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_073260
   00051 Fructose and mannose metabolism
    AFLA_073260
   00052 Galactose metabolism
    AFLA_073260
   00500 Starch and sucrose metabolism
    AFLA_073260
   00520 Amino sugar and nucleotide sugar metabolism
    AFLA_073260
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    AFLA_073260
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AFLA_073260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 459 aa AA seqDB search
MQELFSNVVAALEAMLLFPSLFRDSSGKRKSFHRASWRRRTLDDLADEIDHVFTAPLSLQ
NMAMMSEKIREQLRICLQSSPVSMLPSYNHALPSGTEKGTFLALDVGGSTFRVALIELRG
NGDMEILRVNSSPIDEQVKLLEGTLFFDWMAEKIDSMLSEVGAQYGRELAPLSMGLSWSF
PVEQTSINSGLVIQMGKGFLCSNGTVGQELGDLIVQSCRKRSLNLQMGAIVNDSSATLLS
RAYVDPKTRMSLILGTGTNMAIHFPVHAIGLTNELSMFGGKVLPMSRWDDVINPIEADTS
SSFSSSAALLQKEHTFHRAPTVDDLKFLRRVCEIVSNRSAGYLATAIHSMWSLRNEAEFP
EVTASATSSIKETQEVTVVESEHSQSLTIACDGSVINKYPGFRDRCQGYINQLLQETNAS
KGTLEATPSPSVRLDPAPESGILGAAVAVAVAVAEKTSA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagctcttttcaaacgtcgtcgccgcactagaagctatgctattgtttccatca
cttttccgggattcctccggcaagaggaaatcattccacagggcatcttggcgccgtcgt
accctcgatgaccttgctgacgagatcgaccatgtgttcacagccccactgtccctgcag
aacatggccatgatgtccgaaaagattcgtgaacagcttcgcatttgtctgcagtctagt
ccggtgagcatgctaccgtcctacaaccatgcgctaccatcaggaacggagaagggaacc
ttcctagccctcgacgtaggaggttctaccttccgtgtggctttgattgagcttcgtgga
aacggcgacatggagattctgcgggtcaactcgtccccaattgacgagcaggtgaagctt
ttggagggaaccttattctttgactggatggcggagaagatcgattcgatgctctccgag
gtcggcgcacagtacggtcgagaactcgcgccattgtccatgggcttgtcatggtcattc
ccggtggaacagacgtccatcaacagtggtttagtgattcagatgggcaaggggtttctg
tgctcgaatggtaccgtgggacaggagctaggagatttgattgtccagtcatgtcgcaaa
cgtagtttgaacctccaaatgggtgccattgtaaacgacagctcagctactcttctttct
cgcgcttacgtggaccccaagacccgcatgtccttgattctcggaacgggaaccaatatg
gcgattcatttccccgtgcatgcgatcggattgaccaacgagctgagcatgtttggtggc
aaggttttgccgatgagccgatgggacgatgtgatcaaccccattgaggccgatacgtca
tcgtcattctcttcgtctgcggctctcctccagaaggagcacacgttccaccgggccccg
actgtggatgatctcaagttcttacgtcgtgtctgtgagatcgtttccaaccgctccgcg
ggatacctggcaacagccatccacagcatgtggagtttgcgcaacgaagccgagttcccc
gaagtgaccgcctctgcaacatcgtcgatcaaggagacgcaagaggtgactgtggttgag
agcgaacattcccagagcttgacaattgcatgcgatggcagtgtcatcaataagtaccct
ggcttccgggatcgctgccagggctacatcaatcagctgttgcaggagacgaatgcttcg
aagggcaccctggaagcgacacccagtccatccgtccgcctcgacccggcgcctgaaagt
gggatccttggtgctgctgttgccgttgcggtcgctgtggccgaaaagacatcggcgtga

DBGET integrated database retrieval system