KEGG   Aspergillus flavus: AFLA_073260Help
Entry
AFLA_073260       CDS       T01090                                 

Definition
(RefSeq) hexokinase, putative
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
afv  Aspergillus flavus
Pathway
afv00010  Glycolysis / Gluconeogenesis
afv00051  Fructose and mannose metabolism
afv00052  Galactose metabolism
afv00500  Starch and sucrose metabolism
afv00520  Amino sugar and nucleotide sugar metabolism
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
afv01130  Biosynthesis of antibiotics
afv01200  Carbon metabolism
Module
afv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
afv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_073260
   00051 Fructose and mannose metabolism
    AFLA_073260
   00052 Galactose metabolism
    AFLA_073260
   00500 Starch and sucrose metabolism
    AFLA_073260
   00520 Amino sugar and nucleotide sugar metabolism
    AFLA_073260
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AFLA_073260
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AFLA_073260
Membrane trafficking [BR:afv04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    AFLA_073260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2
Motif
Other DBs
NCBI-GeneID: 7915179
NCBI-ProteinID: XP_002372244
UniProt: B8MVX9
Position
Unknown
AA seq 459 aa AA seqDB search
MQELFSNVVAALEAMLLFPSLFRDSSGKRKSFHRASWRRRTLDDLADEIDHVFTAPLSLQ
NMAMMSEKIREQLRICLQSSPVSMLPSYNHALPSGTEKGTFLALDVGGSTFRVALIELRG
NGDMEILRVNSSPIDEQVKLLEGTLFFDWMAEKIDSMLSEVGAQYGRELAPLSMGLSWSF
PVEQTSINSGLVIQMGKGFLCSNGTVGQELGDLIVQSCRKRSLNLQMGAIVNDSSATLLS
RAYVDPKTRMSLILGTGTNMAIHFPVHAIGLTNELSMFGGKVLPMSRWDDVINPIEADTS
SSFSSSAALLQKEHTFHRAPTVDDLKFLRRVCEIVSNRSAGYLATAIHSMWSLRNEAEFP
EVTASATSSIKETQEVTVVESEHSQSLTIACDGSVINKYPGFRDRCQGYINQLLQETNAS
KGTLEATPSPSVRLDPAPESGILGAAVAVAVAVAEKTSA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagctcttttcaaacgtcgtcgccgcactagaagctatgctattgtttccatca
cttttccgggattcctccggcaagaggaaatcattccacagggcatcttggcgccgtcgt
accctcgatgaccttgctgacgagatcgaccatgtgttcacagccccactgtccctgcag
aacatggccatgatgtccgaaaagattcgtgaacagcttcgcatttgtctgcagtctagt
ccggtgagcatgctaccgtcctacaaccatgcgctaccatcaggaacggagaagggaacc
ttcctagccctcgacgtaggaggttctaccttccgtgtggctttgattgagcttcgtgga
aacggcgacatggagattctgcgggtcaactcgtccccaattgacgagcaggtgaagctt
ttggagggaaccttattctttgactggatggcggagaagatcgattcgatgctctccgag
gtcggcgcacagtacggtcgagaactcgcgccattgtccatgggcttgtcatggtcattc
ccggtggaacagacgtccatcaacagtggtttagtgattcagatgggcaaggggtttctg
tgctcgaatggtaccgtgggacaggagctaggagatttgattgtccagtcatgtcgcaaa
cgtagtttgaacctccaaatgggtgccattgtaaacgacagctcagctactcttctttct
cgcgcttacgtggaccccaagacccgcatgtccttgattctcggaacgggaaccaatatg
gcgattcatttccccgtgcatgcgatcggattgaccaacgagctgagcatgtttggtggc
aaggttttgccgatgagccgatgggacgatgtgatcaaccccattgaggccgatacgtca
tcgtcattctcttcgtctgcggctctcctccagaaggagcacacgttccaccgggccccg
actgtggatgatctcaagttcttacgtcgtgtctgtgagatcgtttccaaccgctccgcg
ggatacctggcaacagccatccacagcatgtggagtttgcgcaacgaagccgagttcccc
gaagtgaccgcctctgcaacatcgtcgatcaaggagacgcaagaggtgactgtggttgag
agcgaacattcccagagcttgacaattgcatgcgatggcagtgtcatcaataagtaccct
ggcttccgggatcgctgccagggctacatcaatcagctgttgcaggagacgaatgcttcg
aagggcaccctggaagcgacacccagtccatccgtccgcctcgacccggcgcctgaaagt
gggatccttggtgctgctgttgccgttgcggtcgctgtggccgaaaagacatcggcgtga

DBGET integrated database retrieval system