KEGG   Aspergillus flavus: AFLA_074520Help
Entry
AFLA_074520       CDS       T01090                                 

Definition
alpha-galactosidase, putative
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
afv  Aspergillus flavus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:afv00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:afv00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:afv00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:afv00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 534 aa AA seqDB search
MRLITRWIPLANALASTMPVQVVASIENPSLLPTPPMGFNNWARFMCDLNETLFVETTDA
MASNGLLEAGYNRINLDDCWMNYDRAENGSLEWNVTKFPRGLPWLGQYVKSKGFNFGIYE
DSGNLTCGGYPGSEGYEEIDAETFAAWGIDYLKLDGCNVYPKEGRTLQEEYKYLYGNWHE
ILSKMQQPLIFSESAPAYFSMTDNLTDWHTVMDWVPEYGELARHSVDILVYSGEGSAWDS
IMTNYKFNTLVARYQRPGYYNDPDFLIADHPGLSLDEKRSQFALWASFSAPLIISAHIPD
LSSEDLEYLTNQALIAVDQDPLAQQATLASRDGSLDVLTRNLADGSRLVTILNHGSESIE
TDISLDILGLSTDCTYKAQDLWGGSTQTIKDAIRIKLNTHATAVYKIDTDEKCSQVIPTG
LIFNTASGKCLTGTSSSVGSESCNGSKSQIWQIDASGVIRTLSEQSKCLTADGKAISLQE
CSENNGQKWSYAITGNLKNADTGYCLTNGGGVSACGFETNSQVFGLPAGVHVAL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttatcacaagatggataccgctagcgaacgcattggccagcacgatgccagtc
caagttgtcgcttccattgagaaccctagtctactgccgacgccgcccatgggattcaac
aattgggcccggttcatgtgcgacctgaacgagacactatttgtcgagactacggatgca
atggcctccaatggtttattggaagctggttacaatcgtatcaatcttgacgactgctgg
atgaactatgatcgcgcggaaaatggatcactcgaatggaatgtcaccaagttcccgcgc
ggccttccctggcttggtcaatatgttaaatctaaaggctttaacttcggcatctacgag
gactcagggaacctgacctgtggtggctatccggggtccgaaggttacgaggagatcgac
gcggagacatttgcggcatggggcatcgactatctgaaattggatgggtgtaacgtctat
cccaaagaaggtcgtactttgcaggaagagtacaaatacctctacggcaattggcatgag
atactcagcaaaatgcaacagccactgatattctccgaatcggcacctgcgtacttctcc
atgaccgacaatttgaccgattggcatacggtcatggactgggttcctgaatacggcgag
ctcgcccgacattcagttgacattctcgtctacagtggagaaggcagtgcctgggatagt
atcatgacaaactataagttcaacacgttagtcgctcggtatcaacgtcccggatattac
aacgatcctgacttcctaattgcggaccatccgggactgtcactggacgaaaagcgatcc
caattcgcgctttgggcttcgttttcggcacccttgattattagtgcacatattcccgac
ctatcatctgaggatctagagtacctaacaaatcaagccttgattgcggtcgatcaggat
cctctggcgcaacaagccacactggccagtcgcgatggctcccttgacgtgttgacgcgg
aatcttgccgacggttctaggttggtcaccattctgaaccatggtagcgagtccatcgaa
acagatatttccctggacatactcggcctctctaccgattgtacatacaaagcacaagac
ctctggggcggctctactcagaccatcaaggatgcgatacgtattaagttgaacacacat
gcgaccgccgtgtataaaatagacaccgatgagaagtgctctcaagtcatacccaccggc
cttatctttaacacggcctccggaaagtgtcttacaggaacctcatcctctgtgggatct
gaatcttgcaacgggagcaaatcccagatatggcagatcgacgcatcgggggtgattcgc
acgttgtctgaacagtcaaagtgtctaacagcagacgggaaagccatttcgctgcaggaa
tgtagcgagaataatggccagaaatggtcgtatgcaatcacgggcaatctaaagaatgct
gatactggctattgtctgacgaacggcggaggtgtttctgcttgcggctttgaaaccaat
agccaggtgtttgggttacccgctggtgtccatgtcgcattgtaa

DBGET integrated database retrieval system