KEGG   Aspergillus flavus: AFLA_075170Help
Entry
AFLA_075170       CDS       T01090                                 

Definition
alkaline phosphatase, putative
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
afv  Aspergillus flavus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AFLA_075170
Enzymes [BR:afv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AFLA_075170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 640 aa AA seqDB search
MVYTSTLLSLLALSTGTWASYNANLNYRSPSTRHTGMGINIDSVHRRSLAKRDEAPFHPS
QLNFTHGVASGDPYADSVILWTRVAPSLEADRSNVTVSGTVGLYNHDTESYIKASAHPIC
VDYRVYEDKEGRRVVDKGRAYTTSDIDYTLKVEASGLKPFTTYWYQFQICNSNVTSPLGR
TKTAPGADDATEEINLAVYSCSNYPNGYFNAYGNAVRKDSVDYVLHLGDYIYESKKGVVG
QDERAVRPEREIFSLYDYRTRLGHYRTDLDLAASHQNFAWIPVWDDHEIADNGYRDGFSR
LNNTEESFRNDSPQISVDQRKMNAVRAYFEWMPLRQVDMDDGLRIWRSFKMGNLFDLIML
DTRNYDRSITDLCMYVPLSEDEANLSDWNTDYIEEIHNDAGRTLMGGRQESWFEKQLTAS
NQRGAKWRIIGSQLRFARLGRETNGEVTYNMDSWEGYRANQNRTLKHLYDNNIGNNIMIA
GDTHVNWVSDIAWIGEKPYDGNTGVGAIGVEFAGTAVSSSGFGGTINSAEQTAASYARNE
DLQWNEGYYRGYFELRMRQDEVEAKYFGCPTVATRNSWEIPLANFTVKHDDNHLSRPIAG
GQVEAGFVHQGEVKHSNLTLNTDTGEWQVIGFDQMFVKYQ
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacacatcgaccctcctctccttactcgccctatccacagggacgtgggcaagc
tacaatgcaaacctaaactaccgcagcccttcaacccgccacaccggcatgggaatcaac
atcgactccgtccaccgtcgtagtctcgcaaaacgcgatgaagcccccttccacccctcg
cagttgaacttcacccatggtgtagcatctggtgacccctacgcggacagtgtgatcctc
tggactcgggtcgctccatccctggaggctgacagaagcaatgtgactgtttcggggacc
gtggggttgtacaatcatgatacagaatcgtatatcaaggcctcggcgcatcctatctgt
gtcgattatcgggtgtatgaggataaagagggccggagggtggttgataaagggagggct
tatacgaccagtgatattgattatactctgaaggtagaggctagtggattgaagccgttc
acgacgtactggtatcagttccagatttgtaactcgaatgtgactagtccgctgggacga
accaagaccgccccgggtgccgatgatgctactgaggagattaacttggctgtttattct
tgcagtaattacccgaatggatatttcaacgcgtatggaaatgccgtccggaaggacagc
gtcgactatgtgctccatcttggagattacatttatgaatctaagaagggtgtggtcgga
caggatgagagagctgttcgaccggagcgagagatcttctccctctatgattatcggact
cggcttggacattatcgcactgatctcgaccttgccgcatcccatcagaactttgcctgg
atccctgtctgggatgatcacgaaatcgccgacaacggctacagagacggtttcagccgt
ctcaacaacacagaagaatctttccgcaatgacagccctcaaatcagcgtcgaccagcgc
aagatgaacgccgtccgggcgtactttgagtggatgcctcttcgtcaagtcgacatggat
gacggtctccgcatttggcgctctttcaagatgggaaacctctttgatttaatcatgttg
gatacccggaattacgatcgcagcattactgacctttgtatgtatgttcctttgagcgaa
gacgaagctaacctgtcagattggaatacggattatatcgaagagatccacaacgatgcc
ggtcggaccctgatgggaggtcgtcaggagtcgtggttcgagaagcagttgacggcgtct
aatcagcgcggcgcgaagtggcgtattatcgggagtcagctccgttttgctcgtttggga
cgggagactaatggcgaggttacttataacatggattcttgggagggctaccgtgcgaac
caaaaccggacgctcaagcacctgtatgataacaacatcggcaacaatattatgatcgcg
ggcgatacacatgtcaactgggtgagcgacattgcctggatcggtgagaagccttatgac
ggcaacaccggtgttggtgccatcggagtcgaatttgctggtacagcggtcagcagctcc
gggtttgggggaacgatcaacagcgcagagcaaactgctgcttcttatgcgagaaacgag
gatctgcagtggaatgaaggctactaccgcgggtactttgagctgcggatgagacaggac
gaggtggaggcgaaatactttggatgccctactgtggctacccggaatagctgggaaatt
cccctggccaactttaccgtcaagcatgacgataaccatctgagtcggcctattgctggt
ggacaggtggaagcgggttttgtccatcagggcgaggtgaagcacagtaaccttacgctg
aacactgacacgggcgagtggcaagtcattgggtttgatcagatgtttgtcaaatatcag
tag

DBGET integrated database retrieval system