KEGG   Aspergillus flavus: AFLA_076680Help
Entry
AFLA_076680       CDS       T01090                                 

Definition
pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
afv  Aspergillus flavus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFLA_076680
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_076680
   00020 Citrate cycle (TCA cycle)
    AFLA_076680
   00620 Pyruvate metabolism
    AFLA_076680
Enzymes [BR:afv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AFLA_076680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 485 aa AA seqDB search
MVASAVRMRTPSAMLIKGASSLRRPQVMHRFKDAVQPQLPAFAALSRYYASKSFPPHTII
SMPALSPTMLAGNIGAWQKKPGDSLQPGDVLVEIETDKAQMDFEFQEEGVLAKVLKETGE
KEVAVGSPIAVLVEEGTDVSSFESFTAEDAGGDKGAAPAQESKEESKGAADAAPASTPAP
EPAAQEPETSGEKLQPSLDREPTISPAAKALALEKGVPIKALKGTGRGGQITKEDVEKYK
PSASAAAGPTYEDIPLTSMRKTIASRLQQSTRENPHFFVSTTLSVTKLLKLRQALNASAD
GKYKLSVNDFLVKACAAALQKVPAVNSSWHEENGQVVIRQHKNADISVAVATPAGLITPV
VKNVQGLGLSSISNSIKDLGKRARDNKLKPEEYQGGTFTISNMGMNPAVERFTAVINPPQ
AGILAVGTTRKVAVPVETENGTEVEWDDQIIVTGSFDHKVVDGAVGAEWIKELKKVVENP
LELLL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccagtgctgtcaggatgcgcactcccagcgccatgctcatcaaaggcgcctcc
tccctgaggaggccgcaggttatgcacagattcaaggatgctgttcaaccccaattgccc
gccttcgctgccctttcccgctactatgcctccaagtccttcccccctcacactatcatt
agcatgcctgctttgtcgccaacaatgcttgctggaaacatcggtgcctggcagaagaag
cccggcgattccctgcagcccggagatgttttggtcgagattgagaccgataaggcacag
atggatttcgagttccaagaagaaggtgtcttggctaaagttctgaaggaaactggtgag
aaggaggttgctgtcggctcccctatcgccgtcctcgttgaagagggcactgatgtttcg
tcgttcgagtcgttcaccgctgaggatgccggtggtgacaagggtgctgccccagctcag
gagagcaaggaagaatccaagggtgctgctgatgctgctcccgcttctacaccggctccc
gagcctgctgctcaggagcccgagacctcgggtgagaagcttcagcccagtctcgaccgt
gagcctactatcagccctgctgccaaggctcttgctctggagaagggtgtgccaatcaag
gcccttaagggcactggccgaggcggtcagatcaccaaggaggatgttgagaagtacaag
cccagcgcttctgccgctgctggccctacctatgaggatatccctcttacatccatgcgc
aagactattgccagccgccttcagcaatccaccagagagaacccccacttcttcgtctca
actactctgtctgtcactaagcttctgaagctccgccaggcccttaacgcctctgccgat
ggcaagtacaagctttccgtcaatgacttccttgtcaaggcttgtgctgcggctcttcag
aaggtgccggctgtcaactccagctggcacgaggagaacggccaggtagtcatccgccag
cacaagaatgccgacatcagtgttgccgttgccactcctgctggactgatcacccctgtt
gtgaagaacgtccagggtctcggcctctccagcatctctaactctatcaaggaccttggt
aagcgtgctcgcgacaacaagcttaagccggaggagtaccagggtggtactttcaccatc
agcaacatgggaatgaaccctgccgttgagcggttcactgctgttatcaacccccctcag
gctggtatcctggctgttggcaccacccgcaaggttgccgtccctgttgagactgagaac
ggtaccgaggttgagtgggacgaccagatcattgtgactggcagctttgaccacaaggtt
gtcgatggtgccgttggtgctgaatggattaaggagctgaagaaggttgttgagaacccc
ttggagctgctgctctaa

DBGET integrated database retrieval system