KEGG   Aspergillus flavus: AFLA_076880Help
Entry
AFLA_076880       CDS       T01090                                 

Definition
stearic acid desaturase (SdeA), putative
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
afv  Aspergillus flavus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:afv01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:afv01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 456 aa AA seqDB search
MSAKTADATQPRAGDIKKVHIADTAITRSNWHKHVNWLNVFLIIGIPMYGCVQALWVPLQ
LKTAIWAVIYYFFTGLGITAGYHRLWAHCSYSARLPLRIWLAAVGGGAVEGSIRWWARDH
RAHHRYTDTEKDPYSVRKGLLYSHLGWMVMKQNPKRIGRTDISDLNEDPVVVWQHRNYLK
VVFTMGLFVPMLVAGLGWGDWWGGFVYAGILRIFFVQQATFCVNSLAHWLGDQPFDDRNS
PRDHVITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWSIWIWKQLGLAYDLKQFRA
NEIEKGRVQQLQKKIDQKRAKLDWGVPLDQLPVMEWDDYVEQAKNGRGLIAIAGVVHDVT
DFIKDHPGGKAMINSGIGKDATAMFNGGVYYHSNAAHNLLSTMRVGVIRGGCEVEIWKRS
QKESTDYVRDSSGQRVIRAGEQVTKIPEPIPTADAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaaagacggcagacgctacccagcctcgtgctggcgacatcaagaaggttcac
attgccgacactgccatcacacggagcaactggcataagcatgtcaactggctgaacgtg
ttccttattatcggcattcctatgtatggatgtgtccaggctctctgggtgcctctgcag
ctcaagactgctatctgggccgtcatctactacttcttcaccggactgggtatcaccgca
ggataccatcgtctgtgggctcactgctcctattccgctcgccttcccctccgtatctgg
ctcgctgctgttggcggtggtgccgtggaaggttctatccgctggtgggctcgtgaccac
cgtgctcaccaccgttataccgataccgagaaggatccctactcagtccgcaagggtctg
ctctactcccaccttggctggatggtgatgaagcagaaccccaagcgtattggccgtact
gatatctccgatcttaacgaagaccccgtcgttgtgtggcaacaccggaactacctcaag
gtcgtcttcaccatgggtctgtttgtgcctatgctcgtggccggtctgggctggggtgac
tggtggggcggtttcgtctatgctggtatcctccgtatcttcttcgtccagcaggcaact
ttctgcgtcaactccttggctcactggcttggtgaccagccatttgatgaccgcaactct
cctcgtgaccacgtcattactgccctcgtcaccctcggtgaaggttaccacaacttccac
cacgaattcccctccgactaccgtaatgctatcgaatggcaccagtatgatcccaccaag
tggagcatctggatctggaagcagcttggcctcgcctatgatctcaagcaattccgtgcc
aacgagatcgagaagggccgtgttcagcagctccagaagaagatcgaccagaagcgtgcc
aagttagactggggtgtccctctcgaccagcttcccgttatggagtgggacgactacgtc
gagcaggccaagaatggccgtggtcttattgccattgccggtgttgtccacgatgtgact
gacttcatcaaggaccaccccggtggcaaggctatgatcaactctggtatcggcaaggat
gccaccgctatgttcaacggaggtgtctactatcactccaacgctgcgcacaacctgctg
tcgaccatgcgggttggagtcatccgcggtggctgtgaagtcgagatctggaagcgctcc
cagaaagagagcaccgattacgtccgtgacagcagcggtcagcgggtcatccgcgctggt
gaacaggttacgaagattccggaacctatccccactgctgatgcagcatga

DBGET integrated database retrieval system