KEGG   Aspergillus flavus: AFLA_079910Help
Entry
AFLA_079910       CDS       T01090                                 

Definition
(RefSeq) glutathione peroxidase Hyr1, putative
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
afv  Aspergillus flavus
Pathway
afv00480  Glutathione metabolism
afv00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AFLA_079910
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AFLA_079910
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AFLA_079910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 7922228
NCBI-ProteinID: XP_002372908
UniProt: B8MY54
Position
Unknown
AA seq 256 aa AA seqDB search
MRSTLSSASIVLRALSSQKPLIYFLAHITSPVAKSPRRSSSTLSSSAKLLLNHQQPRLSA
FHTHTMASATTFFDFEPVDKKGSPFPLTPLKGKTILVVNTASKCGFTPQFEGLEKLYQKL
KSKYPEDFTILGFPCNQFGGQDPGSNDQIQDFCQLNYGVTFPVLGKLDVNGNEASPLWTW
MKEQQPGLLGLKRVKWNFEKFLISPDGKVVGRWASTTKPESLEDTIVKEIEKAQKAGTAA
SVQAKEGESAEQAKLS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcaaccctatcgtctgcgtctatcgtcctacgtgctttatcatcccagaaacca
ttaatctacttcctcgcgcatataaccagccctgtcgcaaaatcgccgcgcaggtcttct
tcaacgctgtcaagctccgctaagctgctactcaatcatcaacaacctcgtttgagcgca
tttcatacgcacaccatggcttccgcaaccaccttcttcgactttgagccagttgacaag
aaaggctctccttttcccctcaccccgctcaagggcaagaccatcctcgtcgtcaacact
gcctccaagtgcggctttactccccagttcgaaggtctcgagaaactctaccagaagctg
aagtccaagtaccccgaagactttactatcctcggattcccttgcaaccagttcggcggc
caggatcccggttccaacgatcagattcaagacttctgccagctgaactacggtgttaca
ttccctgtgttgggcaagctggatgtgaacggaaacgaggcctcacccttgtggacctgg
atgaaggagcagcaacccggtctgctgggcctgaagcgcgtcaagtggaacttcgaaaag
ttcctgatctcgcccgatggcaaggtcgtcggtcgctgggccagtaccaccaagcccgag
tcactcgaggacaccatcgtcaaggagattgagaaggcacagaaggccggaactgcagct
tcggttcaggctaaggagggagagtctgctgagcaggctaagttgtcgtaa

DBGET integrated database retrieval system