KEGG   Aspergillus flavus: AFLA_081430Help
Entry
AFLA_081430       CDS       T01090                                 

Definition
eukaryotic translation initiation factor 3 subunit EifCb, putative
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
afv  Aspergillus flavus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:afv00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFLA_081430
Translation factors [BR:afv03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AFLA_081430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 741 aa AA seqDB search
MAPSFDTLSEQDLHEEEEEEIDFSDLKEQFEVKLEEGLDTFIVIDGLPIVPEESRQKLIK
FLLRKLNAVGHTSEDAVFMPTNDKNMSEGFAFVEYETPEQAIAAVKQLHGTPLDKKHTLA
VNKLMDIDRYGREGRIDEEYKPPTVEPFKEKEHLRSWLSDPNARDQFALYRNDKVGVFWN
NKNNPPENVVDRAHWTQLFVQWSPKGTYLASVHPQGVQLWGGPAFSKQKQFPHPFVQLVE
FSPGESYLTTWSSRPIQVEEGHPVLSFEEDGKNIIVWDIVSGKPLRSFVSHDLAGGPVEG
DAAPKKKVQWPAFKWSADEKYVARMLQGQSISIYELPRMNLLGKTSVKIDGVMDFEWSPA
TVTRDGVKQYEQLLSFWTPEIGSNPARVALMSVPSKEIVRTRNLFNVSDVKLHWQSQGTY
VCVKVDRHSKSKKSMATNLEIFRVREKGVPVEVVDSLKDTVINFAWEPNGGRFVLITTGE
APSGAAVLPKTSVSFFAPEKKGPQAGNFKLVRTIEKKTSNAIYWSPKGRFVVVATVHSQS
NFDLDFWDMDFEGEKAEGEKDLAANLQLMKTVEHYGVTDIDWDPTGRYVVSSASVWTHSM
ENGWNIHTFAGQTLAEHPTDKFKQFVWRPRPPTLLSKEEQKQVRKNLREYSKEFDEEDKY
AVDIANTAVVETRKRVLNEWVAWLRREKELMAEEKDAYGIPEDADDAKVAKDAPPVSEDQ
GEAVVEEIVEEIVEENEEVIG
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccagtttcgataccctgtccgagcaggatctccacgaagaggaggaggaggag
attgacttctccgatctcaaggagcagtttgaagtgaagctcgaggagggcttggataca
tttatcgtcatcgatggactcccgatcgtgccggaagagagcagacagaagcttatcaaa
ttcttgctgaggaaactcaacgcggtcggccacacctccgaagatgccgttttcatgcca
accaacgacaagaacatgtccgaaggtttcgcctttgtcgaatatgaaacccccgaacaa
gccattgccgcagtcaagcagctgcacggaacacctctcgacaagaagcacacccttgcc
gtgaacaaattgatggatattgatcgctatggtcgtgaaggacgcatcgatgaggaatat
aagcccccaactgtcgaacctttcaaggagaaggagcacctccgctcatggttgtccgac
cccaacgcccgtgaccagttcgccctctaccgtaatgacaaagttggcgtgttctggaac
aacaagaacaatccgccagagaacgtcgtcgatcgtgctcattggacacagctcttcgtt
cagtggtcccccaagggtacataccttgcatccgtccacccccagggcgtgcagctctgg
ggcggtcctgctttctcgaaacagaagcagttcccccatccgtttgttcagctcgtcgag
ttctcgccaggtgagagctacttgaccacctggtcttcccgccccattcaggttgaagag
ggtcaccctgtcttgtccttcgaagaggatggaaagaacattatcgtttgggatatcgtc
tctggaaagcctctgcgttccttcgtttctcatgatctcgccggaggccctgttgagggc
gatgctgccccgaagaagaaggtgcagtggcccgctttcaagtggtccgctgatgagaag
tacgtcgcaagaatgctccagggccagtctatctctatctacgagttgcctcggatgaac
ttgctgggtaagacttccgttaaaattgatggagtcatggacttcgaatggtcgccagca
acagttacccgtgatggtgtcaagcaatatgaacaactcctctccttctggactcctgaa
attggtagcaatcccgcaagagtcgccttgatgagcgttccatctaaggagattgtacga
acccgtaacctgttcaacgtctctgatgtgaagctgcactggcagtctcaaggtacctac
gtttgtgtcaaggttgatcgtcactccaagtccaagaaatcgatggctaccaaccttgag
attttccgggtgcgcgagaagggtgttcctgttgaagttgtggacagtctcaaagacacc
gtgatcaactttgcatgggaacccaacggtggacgttttgtcctgatcactacgggtgaa
gcccccagcggtgctgctgttctccccaagacctctgtatctttcttcgctcctgaaaag
aagggcccccaggctggtaacttcaagcttgtgcgcaccatcgagaagaagacgagcaac
gctatctactggtcccccaagggccgtttcgtcgttgtcgccacagttcactctcaatcg
aacttcgatttggacttctgggatatggactttgagggtgaaaaggctgagggtgagaag
gatctggccgccaacctccaattgatgaagaccgtggagcactacggtgtcacagatatc
gactgggatcctacaggtcgctacgttgttagcagtgctagtgtgtggactcattcgatg
gaaaacggctggaacattcacactttcgccggtcagaccctcgctgagcaccctaccgat
aaattcaagcagttcgtttggcgtcctcgcccacccactcttcttagcaaggaggagcag
aagcaagtgcgcaagaacctccgtgagtactccaaggagttcgacgaggaagacaagtat
gctgtcgacattgccaacaccgccgttgtcgagacgcgcaagcgcgttctcaacgagtgg
gttgcctggctccgccgggagaaggagctcatggccgaggagaaggatgcgtacggtatc
cccgaagatgcagacgatgccaaggttgccaaggacgctccccctgtctccgaggaccag
ggcgaggccgttgtcgaagagattgtggaagagattgtggaggagaacgaggaagttatc
ggttga

DBGET integrated database retrieval system