KEGG   Aspergillus flavus: AFLA_083380Help
Entry
AFLA_083380       CDS       T01090                                 

Definition
MAP kinase kinase (Pbs2), putative
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
afv  Aspergillus flavus
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:afv04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 643 aa AA seqDB search
MASEIDPVAGVSPSRDLDNKSDTTDDDLSPSVTTPPASVPSLRPTDKIPGITASSTHLGQ
ISAARRGAGTPPRPQASMSSMSGASQGGLNQDILAKMKAFSLSRQGAPPTLPHAASTGTV
PKTPRPGMPPAGLSSPGGQSPPVVNGPLAGALAGRLPPVARPNTKNWVSSPSIPGSSPSP
VSAKPGGLAAKRMKPGLKLSDATGTNGTAGNQSPANGTEGTGETAFSKYSEFIDTKSGTL
NFKNKAVLHGGGIEFSSGHKFSISLDEVDRLDELGKGNYGTVYKVRHSRPHMRKPGMGLR
GIVSRPTGPEASGSDGVTDNLTGVIMAMKEIRLELDENKFAQIIMELEILHRCVSPFIID
FYGAFFQEGAVYICVEYMDGGSIDKIYKDGVPENILRKMALSTVMGLKTLKDDHNIIHRD
VKPTNILVNSRGQIKICDFGVSGNLVASIAKTNIGCQSYMAPERIAGGGVQQSGASGGGT
YSVQSDIWSLGLTIIECAIGRYPYPPETFNNIFSQLHAIVHGEPPTLPESGYSDEAHSFV
RACLDKNPKNRPSYSTLLRHPWIAPLMRPPEESGGDDTSASAGVTHSSVTEDKEVADWVK
EMLERRNNGLLHDSNKPALHAVALDAVPGSPLLDDPSSISVQP
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgaaatcgatcctgtagcgggggtctcaccttcgagggacttagacaacaag
tccgatactaccgacgacgacctctccccctccgtgaccactccccccgcctcagtgcct
tctttgcgcccgaccgataaaatccccggcattactgcatcgtcgacacacttgggccag
atcagtgcagctcgaagaggcgcgggcacacctccgcgtccgcaggcctccatgagctcc
atgagtggtgcgtcacaagggggcttaaaccaggatattttggcaaagatgaaggctttc
tctctttctcggcaaggcgcacccccgactttgccccatgcggcttcaactggaaccgtg
cctaagactccccgcccggggatgcccccagccggtctgtcgagcccaggaggacaatcc
cccccagttgttaacggtcctttggcgggagctctcgccggccgactgcccccggtagct
cgcccgaacaccaaaaactgggtttcgtctccatcaattcccggctcatcaccgagcccc
gtttccgcgaagccgggtggccttgctgcgaaacggatgaaacctggactcaagctatcc
gatgccaccggcaccaatggcactgctggaaatcagtctcctgccaacggaactgaagga
accggcgagactgcgttcagtaaatattccgagttcattgacactaaatcggggacactg
aacttcaaaaacaaggcagttctgcatggcggcggaattgagttctcatctgggcacaag
ttcagcatttcgctggacgaagttgatcgtcttgatgaattgggcaagggcaactatgga
acagtgtacaaggtccggcatagtcggccacatatgcgaaaacccggtatgggtttgaga
ggcatcgtcagtcgtccgacagggcccgaagcgtctggctccgatggggtcacggataat
cttactggggtcatcatggccatgaaagagatccgcttggagctggatgaaaacaagttc
gctcaaattatcatggagttggaaattcttcatcgctgcgtctcgccctttatcattgat
ttctacggtgccttcttccaggagggagctgtctacatctgcgttgagtatatggatggt
gggtcgattgacaaaatctacaaagatggtgtccctgagaacatcctccgtaaaatggcc
ttatccactgtcatgggactgaaaacactcaaagacgatcacaacatcattcatcgcgat
gttaaacccacgaatattctcgttaactcgcgaggacagatcaagatctgtgatttcgga
gttagtggaaatctggttgccagtattgccaagacaaacattggttgtcagagctacatg
gctccagagcgaatcgctggcggcggagtccagcaatccggagcaagcggtggcgggacc
tatagtgttcaaagtgacatctggagtttagggttgaccatcattgaatgtgccattggc
cgatatccatatcctccggagacctttaacaacatcttcagtcaactgcacgctattgtt
cacggagagccaccaacacttccggagtctggatattctgacgaagctcattcctttgtc
cgtgcttgtttagacaaaaatcccaagaatcgtccttcgtacagtacgttgctccgacac
ccctggattgcgccccttatgcgcccaccagaggagtcgggcggcgatgatacgtctgcc
tcggctggggtcacccattcctctgtcactgaagacaaggaggtcgccgactgggttaaa
gagatgctggagcgtcgcaataatggccttctgcatgattctaataagccggcactacat
gctgtcgccttggatgctgttccgggcagccctcttcttgatgatccttcctcaatttcc
gtacaaccttga

DBGET integrated database retrieval system