KEGG   Aspergillus flavus: AFLA_083430Help
Entry
AFLA_083430       CDS       T01090                                 

Definition
choline kinase, putative
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
afv  Aspergillus flavus
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AFLA_083430
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     AFLA_083430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 770 aa AA seqDB search
MPSFTDHNGDSGPDIEGFQPIYGTGLSITSLQKARHANGNGNTAIAPDSRKHHPAISKKA
TARPPLYPTAPLSSQSSAISESGARDEQEMQNGEEDPQNALFHQVLEWLQREKSKRKSPK
VKAHAQPDGSGSDGDDEDDEDAGNGDGGNSERTTSHGADNVFALDKLEKILIQYAASRSD
GAAPAYPARRSTRRRHVKGLRRGSASESDYLDGDSAAPSVDATLDNSKTLAYSGGGAEDD
ENEEGANARRALDREAWFVFKSEILRITHTLQLKGWRKLPMELASDVGVVRLSGALTNAV
YVVTPPQNIPPPRAEDGSYSLVPRKPPPKLLLRIYGPQVDHLIDRENELQILRRLGRKHI
GPRVLGTFNNGRFEEFFEARPLTPKELRDPGTMKQIAKRMRELHEGIELLDNEREGGPMV
FKNWDKWVDRCEQVTNWLDKEIQSKHNDIKAVAEPWRRRGFVCGVPWPTFRKAVDSYRNH
LINSYGGMQEIKRQLVFAHNDRSCGPRLTMQTQYGNLLRMEPSSESPLLRPENEHKQLVV
IDFEYASANLPGFEFANHFTEWCYNYHDPERSWACSSRDFPTLEQQHRFISAYLTHRPGL
AVRSSPSITPLMQAGELANITSLAPLDLDAGPDVDQQSLVDAEKAQEDRTEAEIRSLIKQ
ARLWRVFNSAQWVAWGIVQAKVPGMEEGIAADAATNGHQNGANGTESEGTPSTTPPPDTD
VEETDEFDYLAYAQDRAMFFWADLLSLNLVREEELPAALIQHIKPRIIDY
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgccttccttcaccgaccacaacggggactctggtcctgatattgaaggatttcaaccg
atttacggtaccggtcttagcatcacctcactgcagaaggcccgtcacgcaaacggcaat
gggaataccgcaattgcgcccgactccagaaagcatcatcctgccataagcaaaaaggca
accgcacgcccaccactctaccccacagcgccattaagcagtcaatctagtgccataagc
gagtcaggtgcacgggatgaacaagaaatgcagaacggcgaagaagatccgcagaatgcc
cttttccaccaggtcttggaatggcttcagcgtgaaaaatctaaacggaaatctcccaaa
gtaaaagcgcatgcacaaccagatggttcgggtagcgatggggatgatgaggatgatgaa
gacgctggtaatggggatggtggcaactcggagaggacaacttctcatggggccgacaat
gtatttgccttagacaagctggagaagatcctcatccagtacgctgcttcacgcagtgat
ggcgctgcgcctgcttatcccgctcggcggtcaacccgccggcgtcatgtgaagggccta
cggaggggttctgcctctgaatctgattacctagatggcgactcagctgctcccagtgtt
gatgcgacattagacaactctaaaaccctcgcgtacagcgggggtggtgccgaagatgac
gagaatgaagaaggtgcaaatgccaggcgggccctggatcgggaggcttggtttgtattc
aaaagtgagatactgcgtatcactcacacgctacaactcaaggggtggcggaagctgccg
atggaactcgccagtgatgtaggagtagttcgactgagcggtgcgctaaccaatgctgtg
tatgtggtcacgccgcctcagaatatccctccccccagggccgaagatggctcttacagc
ctcgttcccaggaagcccccaccgaagctgcttctgcgcatttacgggccccaggtggat
cacctcatcgaccgggaaaacgaactgcagattctacgtcgtttggggcgcaagcacatc
gggccccgagtgctgggaactttcaataacggccgcttcgaagagttcttcgaggcccgt
cctttgactccaaaagaactgcgcgatcccgggacaatgaagcaaatcgcaaagcgtatg
agagagctgcatgagggcattgagttactcgacaatgagagggaggggggaccgatggta
tttaagaactgggacaaatgggtggaccgctgcgaacaagtcaccaactggttggataag
gaaatccagtccaagcacaatgatattaaagcagttgcagaaccttggcgacgccgaggc
tttgtctgcggtgttccgtggccgacgttcaggaaagccgtcgacagttaccgaaaccac
ctcataaacagctatggtggcatgcaggagatcaagcggcaacttgtctttgcccataat
gatagatcctgtggaccaaggctgactatgcagactcaatatggtaatcttcttcgaatg
gaacctagttctgagtctcctctccttcggccggaaaatgagcacaagcagctggttgtc
attgatttcgagtatgcatccgcgaatctccctggatttgagttcgcaaaccattttacc
gaatggtgctacaattatcacgacccagaaagatcctgggcatgcagtagcagagacttc
cccaccctggagcagcaacatcgctttatcagtgcttatttaacacatcgacctggcttg
gccgtgcggtcatctccatctataaccccactcatgcaagcaggagaacttgctaacatc
acttcactcgctcctttggacctggacgcaggacctgatgtggaccaacagagcttggta
gatgctgagaaggcccaggaggaccggacggaagcggaaatccgatcactaatcaagcag
gctcggctctggcgtgtgttcaactcagcgcagtgggtggcatggggaatagtgcaagcg
aaggtgcccggcatggaagagggcatcgcagccgatgctgcgacaaatggccatcaaaac
ggcgccaatggcacagaatccgaggggactccttcaacaacccctccaccggatactgat
gtggaggaaacagatgaatttgattatcttgcttatgcccaagaccgggccatgttcttc
tgggcagatttgttatcattaaacctcgttcgggaggaggaattgcctgcagctttgatt
caacacattaaaccccgcattatcgactactaa

DBGET integrated database retrieval system