KEGG   Aspergillus flavus: AFLA_084510Help
Entry
AFLA_084510       CDS       T01090                                 

Definition
dsDNA-dependent ATPase (Rad54b), putative
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
afv  Aspergillus flavus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:afv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AFLA_084510
Enzymes [BR:afv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     AFLA_084510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 885 aa AA seqDB search
MREKDRDQKTRKLTVFRRKPTTKKNKTWDGDGILSVRNGYAHLRDVSGKDMGRAIQASYL
EPGTMLSIGGKEVEIDSEMSKNEYLSGKQFLEAKPSPTPPVAPPKKGFVSVSGNKPSTSA
AKENPGEKGQMQIIPNPASRKQSSISSAYKRPLLENTIIPQKSEEEPVPRHDPKQPGALV
MKRPASAPKGKRIVDVVVDPILAKHLRPHQREGVKFLYECVMGMRSFNGQGAILADDMGL
GKTLQTITLLWTLLKQNPIYENPPEVKKALIVCPVTLINNWRKEFRKWLGNERIGVFVFD
DKRKRLTDFTRGRAYNIMIVGYEKLRTVQEGLAQGAGVDIIIADEGHRLKTLQNKSGQAI
QSLNATKRVILSGTPIQNDLKEFFAAVDLVNPGVLGNFKAFVREFEVPIVKSRQPEATRK
DIEKGEARNEELRELTSQFMLRRTADILANYLPPKSEYILFCDPTPTQANIYQNVLASPV
FQCAVGNSENALQLITILKKLCNSPSLLSPRNVDEKPSETIAALLSSLPPNLLRHFSPSS
SAKIRVLDQLLHILHTSTSEKVVLVSNYTSTLNLLATLLTSLSLPFLRLDGSTPAQKRQS
LVEDFNRFPTNRCFAFLLSAKAGGTGLNLIGASRLILFDVDWNPATDIQAMARIHRDGQK
RHCRIYRILLKGSLEEKIWQRQVTKLGLADSVMEHKDNAAQFSRDELKDLFRLDQDSKCQ
THELLGCDCGGRGQNVSTSDSHAGSPADGQGNVLDSDDSEEVEEDFPDVLTLIKASKLDM
KKQERMIEATRGARRGGRTTKSTDGTKSDKQKDKMQQSLSQYSHIDPCHLTTTTDDTQDI
QQVIDDDVLLSMLKEEDNRISFVFKKSSVALAKDTDSSMPVVLSD
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgagagagaaggacagggaccaaaagacaagaaagctgacagttttcaggcggaaacct
accactaagaagaataagacctgggatggtgatggtatactctcagtgcggaatggctat
gctcatttgcgagacgtctcgggcaaggacatgggccgggctatacaagcctcttatctt
gaacctggaactatgctctcgatcggaggcaaggaagttgagatcgactccgaaatgtcg
aagaacgagtatctgtccgggaagcagtttcttgaagcaaagcctagcccaactccgccg
gtagcgccaccgaagaaaggttttgtgtctgtgtcgggaaacaagcctagcacgtcggct
gccaaggagaacccaggggagaaaggtcaaatgcagattattccgaatcctgcatcgagg
aaacagagctctatatctagcgcatacaaaagacccctgttagaaaatactattatccca
cagaaatctgaggaggagcccgttcctcgtcatgaccccaagcagcccggtgcactggtg
atgaaacggccagcatccgctcctaaggggaaaagaattgtcgacgttgtggttgatcct
attcttgccaaacacttgcggccgcatcagcgtgagggagttaagttcctttatgaatgt
gtcatggggatgcgatcgttcaatggccaaggtgctattttagcggacgatatgggcctg
ggtaaaaccttgcagacaatcacgctattatggaccttgcttaaacagaatccgatctat
gagaatccccctgaagttaagaaagcacttatcgtgtgccctgtgactttgatcaataac
tggaggaaggaattccggaaatggcttgggaatgaacgaattggcgtatttgtctttgat
gacaagcgaaaacgactgactgattttaccaggggtagagcatacaatatcatgattgtt
ggttatgaaaaattaagaaccgtgcaagaaggacttgcacaaggagctggggtcgacatc
ataattgcggatgagggccacagactcaaaacacttcaaaataagagtggacaggcgata
cagtcgctgaatgccactaaaagagtgattctctcgggtactccgatccagaatgacctg
aaggaattcttcgcggcggtggatctcgtgaacccgggagttctgggaaatttcaaggca
tttgtacgcgaattcgaggttcctattgtgaagagcagacagccagaggcaacaaggaaa
gatatcgagaagggagaagccagaaatgaagagctccgtgaacttacctctcagttcatg
ctacggagaaccgcggacattcttgcaaactaccttccaccaaagtcagaatacatactc
ttttgcgacccaacgcccacccaagcgaacatttaccaaaacgtgctcgcgtcacctgta
tttcaatgtgccgttggcaactcagagaatgctctacagctcatcactattctgaagaag
ctctgcaacagcccttcactgctttccccaagaaatgtagacgaaaaacccagcgaaaca
atcgcagctctactatcctctctacctccgaacctcctacgacacttttctccatcctcc
agcgctaaaatccgagtcctagaccaactactacacatcctgcatacctcaacttcagag
aaagtcgttctcgtttcaaactacacatccacgctcaatctgttagctacgctcctaacc
tcattatcacttccatttctacgactagatggctcgactccagcgcaaaaaagacaatcc
ctagtcgaagacttcaaccgcttcccaacaaaccgctgcttcgcattcctcctatctgct
aaggcaggaggcacggggctgaatctaataggcgccagccgcctcatcttattcgacgtg
gactggaacccagccaccgacatccaagccatggccagaatccaccgcgacgggcaaaaa
cgacactgtcgaatataccgcatcctactgaagggcagcttggaagagaagatctggcaa
cgccaagtgaccaagctcggactcgcagatagcgtcatggaacacaaggataacgctgcc
cagttctctcgagatgaactaaaagacctcttccgtctcgaccaggatagcaaatgtcaa
acgcacgagcttctaggctgtgattgtgggggcaggggacaaaatgtgtcaacctcggac
tctcacgctggctccccggcagacggacaaggcaatgtattggattcagatgattcagag
gaagtggaagaggacttcccggacgttctgaccctcattaaagcttccaagctggacatg
aagaagcaagagcgcatgattgaggcgactcgcggggcacgccgtgggggtagaacgacc
aaaagcactgatggcaccaaatctgacaagcaaaaggataagatgcagcagtcgctgtct
caatactcccatatcgatccctgtcacctaacaaccacaactgatgatacgcaagatatc
caacaagttattgatgacgacgtgcttctctctatgttaaaagaagaggataataggata
agtttcgttttcaagaaatctagcgtggcgttggcaaaggacacggattcgtcgatgccg
gttgttttatcggactaa

DBGET integrated database retrieval system