KEGG   Aspergillus flavus: AFLA_085510Help
Entry
AFLA_085510       CDS       T01090                                 

Definition
trytophan synthase alpha subunit, putative
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
afv  Aspergillus flavus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AFLA_085510
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFLA_085510
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AFLA_085510
Enzymes [BR:afv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AFLA_085510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 641 aa AA seqDB search
MEHLKQTFAQCQQEGRPALVTYVTAGFPTAEETPDIMLGMQAGGADIIELGLPFTDPIAD
GPTIQKSNLKALKNGVTITSMLEMVREARRKGLKTPVLFMGYYNPLLRYGESQILADCKD
AGVNGFIIVDLPPEDAIRFRNGCTKMGLSYVPLIAPSTTEERMKALCSMADSFIYLVSRM
GVTGATGTLNTELPALIQRVKSLSGNVPVAVGFGISTREHFLSVTSIADGAVIGSQVINI
LADAPAGQAAQAVEDYCSKITQRKVSADASTTISGTTEAKAVALTDDAEAAVADGPGRFG
IFGGQYAPEALTTCLAELEAGFQAALDDPTFWEEYRSYYPYMGRPSSLHQATRLTEHVGG
ANIWLKREDLNHTGSHKINNALGQILIARRLGATVIPVESGSRTLRDAVNEAFRAWIVRL
DTTHYIIGSAIGPHPFPTMVRTFQSVIGNETKAQMQELGKSPDAVVACVGGGSNSVGMFY
PFSKDLSVQLVGVEAAGDGLDTDRHSATLTGGSVGVLHGVRTYILQDEHGQISDTHSISA
GLDYPGVGPELAHWKESKRATFLSATDAQAFEGFRLLSQLEGIIPALETSHAVWGAIQTA
KKLGPGKDLVLCLSGRGDKDVQSVADGLPTIGPQIGWDLRF
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctcaaacaaacatttgcccaatgtcaacaagaaggccgtccagcgctggtc
acgtatgtgacggccggattccccacggcggaggaaaccccggacatcatgctgggcatg
caggccggaggagccgacattattgagctgggtctcccattcaccgaccctatcgcagat
ggtcctaccatccagaaatcgaatctgaaggccctcaaaaatggggtcaccattacctcc
atgttggagatggtgcgggaggcccgccggaaaggactcaagacccccgtcctcttcatg
ggctattacaacccccttttacgctatggggagtcccaaatcctggccgattgcaaggat
gccggagtcaatggtttcattattgttgatttgccaccagaagacgcgattcgcttccgc
aatggctgtaccaagatgggtctctcctacgtcccattgatcgctccttccactacagaa
gagcgcatgaaggctctctgcagtatggcggattctttcatttatcttgtgtcccgtatg
ggcgtcaccggtgctacggggaccctcaacacagagcttccggcgctcatccagcgcgtc
aagagcctctccggcaatgtccccgtcgcagttggatttggaatcagcacgcgggagcat
tttctaagcgtgacctccatcgccgacggtgctgtcattggtagtcaagtgatcaacatc
ctggctgacgccccagccgggcaggccgctcaggcagttgaggactactgttcaaagatc
acacaaaggaaagtctctgcagatgcatcgactacaatcagcgggacaaccgaagcaaag
gcggtcgccctaaccgatgacgcagaggcagccgtggccgatggaccaggacggttcggt
attttcggtggtcaatatgcccccgaggccctgacaacgtgtctcgctgaactcgaggcc
ggtttccaggcagctctcgatgacccgaccttttgggaggaatatcggtcgtactatcct
tacatgggccgtccatcgagccttcaccaagcgacacgcctgactgagcacgtcggtggt
gcaaacatctggctaaaacgggaagacctgaaccacaccggatctcacaagattaataat
gccttgggtcagatactcatcgctcgtcggttaggcgccacggtgatccccgtcgaatcg
ggatcgcgtaccctccgtgatgccgtaaatgaagccttccgcgcgtggattgtccgtctg
gataccacccactatattatcgggtctgccattgggccccatcccttccctactatggtc
aggactttccagagtgtgatcggtaatgaaaccaaggctcagatgcaagagctgggcaag
agtccggatgccgttgttgcctgtgttggtggaggatctaattctgttggcatgttctac
cccttttccaaggatctctctgtccagctggttggtgtagaagccgccggagatgggtta
gacacggaccgacactccgccacactgactggaggctctgtaggcgtgctgcatggcgtt
cgcacatatatcctacaggacgagcacggccagatctccgacactcattccatttccgcc
gggctggattaccccggagttggaccggaactggcccactggaaggaaagtaagcgggca
acatttctgtccgctactgatgcccaggcctttgagggcttccgcctcctgagccagttg
gaaggcattatccctgcgttggaaacttctcacgctgtgtggggtgctattcagacagcc
aaaaagctgggacctggcaaggacctcgtcttgtgtttgagtggtcgcggagataaggac
gtgcagagcgtggctgatggattgcccacgattggaccccagattggatgggacttacgg
ttctaa

DBGET integrated database retrieval system