KEGG   Aspergillus flavus: AFLA_086320Help
Entry
AFLA_086320       CDS       T01090                                 

Definition
endosome-associated ubiquitin isopeptidase (AmsH), putative
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
afv  Aspergillus flavus
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:afv00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AFLA_086320
Enzymes [BR:afv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AFLA_086320
Peptidases [BR:afv01002]
 Metallo Peptidases
  Family M67
   AFLA_086320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 461 aa AA seqDB search
MASHMPPATGAGASAPRKVEEITQMAQNYDYNPSIPLRYWLRTAATLLREARIYEREGHD
EQAYFLLFRHAQLVLVNLAKHSEAKDEQNRKALMEAEKEVSRNLEKLEILRPRINKRHKR
YTELMNDRQARSPPLGTNHTAPNQQQPQDPALVGVAEPLEAGENRDLAVKLARTEIHRRA
TARKAVRQAGITPQEEQRRRTAGIWGDWENALDKNGPETDNDLSRRIQNISTPLTSAAQT
QAPAPPAKVKPVADGGDGRSNLDPSSFTFKPSAYLENGTPLRTVFLPPELRSTFLSLAAS
NTRRNLETCGILCGTLISNALFISRLLIPEQTSTSDTCETVNETAIFEYCDSEDLMILGW
IHTHPTQTCFMSSRDLHTHSGYQVMLPESIAIVCAPSKTPDWGVFRLTDPPGLKTVLNCT
QPGLFHPHAETNTYTDALRPGHVFEAKGLEFETVDLRPNGS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgcatatgccgccggccacaggcgcgggggcctcagcccctcgaaaggtcgag
gaaatcacccaaatggcgcagaactatgattacaacccttcgattcctctgcggtattgg
ttaagaaccgcagcgactctactgagagaggctcgtatatacgaacgagaggggcacgat
gaacaagcgtacttccttctatttcgccatgctcagttggtgctggtaaacctggcaaaa
cattcggaagccaaagatgagcagaatcggaaagctctgatggaagcagagaaggaagtt
agcaggaatcttgaaaagttggagattctcagacctcgaatcaataaacgacataaacgc
tatacagagttgatgaatgatcgtcaagctcgaagcccacctttaggaacgaaccacacc
gcaccgaaccagcagcagccccaggatcccgcattagtaggtgttgccgagcctctggag
gctggcgagaaccgagacctggcggtcaaactagcgaggacggaaatacaccggagggct
acggccaggaaagctgtacgtcaagctgggataacaccccaagaggagcagcgccggcgc
acggcaggtatctggggcgactgggagaacgctctggacaagaatggcccagagacggac
aatgacttgagtcgacggattcaaaatatctccacgcccctgacatccgcagctcaaaca
caagctccagctcctccggcgaaagtaaaaccagtcgcagatggtggggatggccggtca
aacctggacccttctagcttcaccttcaaaccgtccgcctacctggagaatggcacccct
ctccggacggttttcctgccccccgagctacggtcaacgttcctttcgctggccgcttcg
aacacacgacgcaacctggaaacatgtggtatactttgtgggactttaatatccaacgct
ctgttcatctcccgacttctcatccccgagcaaacttccacatcggacacttgtgaaacg
gtgaacgagactgccatatttgagtactgtgactcggaggatttgatgatcctcggctgg
attcatacccacccgacccaaacttgcttcatgagctctagagacctgcatactcactct
ggataccaagtgatgcttcctgagagcattgcaatcgtctgcgctccgagcaaaacgcca
gactggggcgttttccggttgactgacccgcccgggctcaagacagtcctcaactgtacg
cagcccggtttgtttcacccacacgccgagaccaacacctacaccgatgcgctacgaccc
gggcatgtgttcgaagccaagggcctcgaattcgagacggtggatctccgccctaacgga
tcctaa

DBGET integrated database retrieval system