KEGG   Aspergillus flavus: AFLA_087870Help
Entry
AFLA_087870       CDS       T01090                                 

Definition
endoglucanase, putative
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
afv  Aspergillus flavus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFLA_087870
Enzymes [BR:afv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AFLA_087870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 333 aa AA seqDB search
MKFRNLFFAAVAGSAVAAPLAKEQKKRDSVFQWIGANESGAEFGENNLPGVWGTDYIFPD
VSAITTLIDKGMNIFRIQFKMERLVPDSMTGAYDEAYLQNLTTVVNAVTDAGVHAILDPH
NYGRFNGEIMSTPSDFQTFWKNLAGQFQSNSLVIFDTNNEYHDMDQELVLNLNQAAIDGI
REAGATEQYIFVEGNSYTGAWTWTDVNDNMKNLEDPQDKIVYQMHQYLDSDGSGTSETCV
SGTIGQERVTSATQWLKDNKKVGIIGEFAGGNNDQCKTAVKGMLDYLAENTDVWKGALWW
AAGPWWGDYMYSLEPPNGVAFTGMLDVLQAYLG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaattccgtaaccttttctttgctgccgtagctggctctgcggttgctgctcctctg
gctaaggagcaaaaaaagagggattcagttttccaatggatcggcgccaatgagtcgggt
gctgaattcggcgagaacaacctccctggcgtatggggtacagattatatcttcccggat
gtctcggccattaccaccttgattgataaggggatgaatatattccgtatccaattcaag
atggagagattggttccagactcaatgacgggggcatacgatgaggcctacctgcagaac
ttgaccacggtggtcaatgccgtcactgatgcgggtgtccatgctatcttggacccccat
aactatggcagattcaatggcgagatcatgtccactccatctgatttccaaacattctgg
aagaacttggcaggacagttccagagcaactctttggttatcttcgataccaacaatgaa
taccatgacatggaccaagagctggtcctgaacctcaaccaagccgccattgacgggatc
cgagaggctggcgccacggagcaatatatcttcgttgaaggtaactcgtacaccggggcc
tggacctggaccgatgtgaacgacaacatgaagaacttggaggatccccaggacaagatc
gtctatcagatgcaccagtatttggactcggatgggtctggtacttccgagacctgcgtg
tctggtaccattggccaggagcgtgtcaccagcgctactcaatggctcaaggacaacaag
aaggtcggtatcatcggtgaattcgcgggtggaaacaacgaccagtgcaaaactgccgtg
aagggaatgctggattatctggctgagaacaccgacgtgtggaagggtgcgctttggtgg
gcggccggtccatggtggggagattatatgtacagtttggagcctccaaacggagttgcg
ttcacgggaatgttggacgttctgcaggcatacctggggtag

DBGET integrated database retrieval system