KEGG   Aspergillus flavus: AFLA_088590Help
Entry
AFLA_088590       CDS       T01090                                 

Definition
nuclear pore complex protein (SonA), putative
Orthology
K14298  
mRNA export factor
Organism
afv  Aspergillus flavus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:afv00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFLA_088590
Messenger RNA biogenesis [BR:afv03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     AFLA_088590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 363 aa AA seqDB search
MSLFGSVGTTSTTAGQTNTTGDISKDVALNSPPEDSISDLQFSPASEHLAVASWDKKVRI
YEINDQGQSEGKALFEHEAPVLSCCWAPDGTKVVGAGADKAARMLDLAANATTPVQVAAH
DAPIKCCQMIPNPAGGTPLLVTGSWDKTVKYWDLRQSTPIATVECQERVYTMDVKNKLLV
VGTADRYINIINLDNPTKFYKTMQSPLKWQTRVVSCFTDATGFAVGSIEGRCAIQYVEDK
DSSSNFSFKCHRETPPNQRDINNIYSVNAISFHPVHGTFSTAGSDGTFHFWDKDAKHRLK
GYPSVGGTISSTAFNRNGNIFAYSVSYDWSKGYSANTQQLPNKVMLHPVAQEEVKPRPGT
RKR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcttcggttctgtcggcactacgtcgacaacagcgggccaaacaaacaccacc
ggcgacatatctaaagatgtcgctctcaattcgcctcctgaagatagcatttctgatctt
cagttttcccccgccagtgaacatcttgcggtagcttcttgggacaagaaagtccgcatt
tatgagatcaatgatcagggacagagtgaaggaaaagctctctttgagcatgaagctcca
gttttaagctgctgctgggcaccggatggaactaaagtagtaggcgctggtgccgataag
gctgcacgcatgctcgatctcgctgcaaatgctacgacccccgtccaggtcgcagctcac
gatgctccgatcaaatgctgccagatgattccgaatcctgctggaggtacacccctccta
gtgaccggctcgtgggacaagacagtcaaatactgggatctacggcaatcgaccccgatc
gccacggtagaatgtcaggagcgtgtctacaccatggatgtcaagaacaagctgctagtg
gttggaactgcagaccgatacattaacatcatcaatctcgacaatcccaccaaattctac
aaaactatgcaatcccctctcaagtggcagacgcgagtagtcagctgcttcacagatgct
acggggtttgctgttggcagtatcgagggccgctgtgctattcagtacgtggaggacaag
gactctagctcgaacttcagcttcaaatgtcatcgagagacacccccaaaccaacgcgac
atcaataacatctattccgtcaatgctatctctttccacccggttcatggcactttcagc
accgctggcagcgatggaacctttcacttctgggacaaagacgccaaacatcgcctaaag
ggatatccctcagtaggggggaccatctccagcaccgcattcaaccgcaatggcaatata
tttgcctactctgtgagctacgactggagcaaaggctactcggccaacacccaacagctt
cctaataaagtaatgcttcatccagttgctcaagaagaggtgaagcccaggcctggtacc
aggaagaggtaa

DBGET integrated database retrieval system