KEGG   Aspergillus flavus: AFLA_088770Help
Entry
AFLA_088770       CDS       T01090                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
afv  Aspergillus flavus
Pathway
afv00230  Purine metabolism
afv01100  Metabolic pathways
Module
afv_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AFLA_088770
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AFLA_088770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_18 ABC_tran RsgA_GTPase AAA_22 MMR_HSR1 RNA_helicase AAA_24 dNK AAA_28 DUF2075 AAA_29 NACHT AAA_14 cobW AAA_30 AAA_17 ATPase_2 T2SSE
Motif
Other DBs
NCBI-GeneID: 7917677
NCBI-ProteinID: XP_002373790
UniProt: B8MWS7
Position
Unknown
AA seq 230 aa AA seqDB search
MQGFSKSRITLHIYSGRFQLFTRRSVLTMSTTAGSLQKFRPVVVSGPSGAGKSTLLKRLF
ADYPDTFGFSVSHTTRAPRPGEQHGREYYFTTKADFLDLVSKNGFIEHAQFGGNHYGTSV
QAVKDIAKKGRICILDIEMEGVKQVKRTDLNARFMFLAPPSVEELERRLRGRGTESEESL
SKRLAQAKNELEYAKEPGAHNKIVVNDDLEKAYTELRDWIVDDGRFGAEQ
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcttttcaaagtctcgtataaccttgcatatttacagtggacgtttccagttg
ttcactcgccgctcagtattgacaatgtcaaccactgctggatccctgcaaaagtttcgc
ccagtagtggtatcgggcccctctggtgctgggaaatcaactctactcaaacgactgttt
gctgattatcccgatacctttgggttttctgtttcgcacaccaccagagctccacgaccg
ggtgagcagcatgggcgcgaatattatttcacaaccaaagcggacttcctggaccttgtg
agcaaaaatgggttcattgaacatgcgcagtttggagggaaccactatggtaccagtgtc
caggccgtgaaagatattgccaagaagggtaggatttgcatcctcgacattgagatggag
ggcgtgaagcaagtgaagcgtactgacctgaacgctcgctttatgtttctcgcgccgccg
tcggttgaagagctagaacggagattgcgaggtagaggcactgagtccgaagagagcttg
agtaaacgcttagcacaggccaaaaatgaactcgagtatgctaaggagcccggcgcacat
aacaagatagtcgtcaatgatgatttggaaaaagcctatactgagttgagggactggatt
gtcgacgatggtagattcggcgctgagcaataa

DBGET integrated database retrieval system