KEGG   Aspergillus flavus: AFLA_088770Help
Entry
AFLA_088770       CDS       T01090                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
afv  Aspergillus flavus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:afv00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 230 aa AA seqDB search
MQGFSKSRITLHIYSGRFQLFTRRSVLTMSTTAGSLQKFRPVVVSGPSGAGKSTLLKRLF
ADYPDTFGFSVSHTTRAPRPGEQHGREYYFTTKADFLDLVSKNGFIEHAQFGGNHYGTSV
QAVKDIAKKGRICILDIEMEGVKQVKRTDLNARFMFLAPPSVEELERRLRGRGTESEESL
SKRLAQAKNELEYAKEPGAHNKIVVNDDLEKAYTELRDWIVDDGRFGAEQ
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcttttcaaagtctcgtataaccttgcatatttacagtggacgtttccagttg
ttcactcgccgctcagtattgacaatgtcaaccactgctggatccctgcaaaagtttcgc
ccagtagtggtatcgggcccctctggtgctgggaaatcaactctactcaaacgactgttt
gctgattatcccgatacctttgggttttctgtttcgcacaccaccagagctccacgaccg
ggtgagcagcatgggcgcgaatattatttcacaaccaaagcggacttcctggaccttgtg
agcaaaaatgggttcattgaacatgcgcagtttggagggaaccactatggtaccagtgtc
caggccgtgaaagatattgccaagaagggtaggatttgcatcctcgacattgagatggag
ggcgtgaagcaagtgaagcgtactgacctgaacgctcgctttatgtttctcgcgccgccg
tcggttgaagagctagaacggagattgcgaggtagaggcactgagtccgaagagagcttg
agtaaacgcttagcacaggccaaaaatgaactcgagtatgctaaggagcccggcgcacat
aacaagatagtcgtcaatgatgatttggaaaaagcctatactgagttgagggactggatt
gtcgacgatggtagattcggcgctgagcaataa

DBGET integrated database retrieval system