KEGG   Aspergillus flavus: AFLA_088870Help
Entry
AFLA_088870       CDS       T01090                                 

Definition
porphobilinogen synthase, putative
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
afv  Aspergillus flavus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AFLA_088870
Enzymes [BR:afv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AFLA_088870
Exosome [BR:afv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFLA_088870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 301 aa AA seqDB search
MLIYPLFITDNPDEETPIPSLPGQYRRGLNRLVPFIKPLAHKGLRSVILFGVPLHPSAKD
ALGTAADDPSGPVIQAIRLLRSRFPQLYIVTDVCLCEYTSHGHCGILREDGTLDNTQSVD
RISDVALAYAAAGAHCVAPSDMNDGRVRAIKLKLIEAGMAHRVLLMSYSAKFSGCLYGPF
RDAAGSCPSFGDRRCYQLPPGGRGLARRAIQRDIGEGADIIMVKPASSYLDIIRDAKEIA
KDIPIAAYQVSGEYAMIHAGAKAGVFDLKSMAFESTEGIIRAGAGIIVSYFVPDFLDWLS
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcttatttatcctctcttcatcaccgataatcccgatgaggagactcctatcccgtct
ctccctggacagtatcgtcgaggattaaaccgtctagttcctttcatcaaaccacttgcc
cacaaggggctacgctcagtcatcctgtttggcgtcccactacacccctctgcgaaggat
gcactaggtaccgctgcagacgatccatctggaccggtaattcaagctattcgcttgctt
aggtcgcggtttcctcaactttatatcgtgacagatgtgtgcctttgcgagtatacttcg
catggccactgtgggatactgcgagaagatgggactcttgataatacacagtctgtggat
cggatttcggatgttgctctggcttatgctgccgccggagcccattgtgtcgctccgtct
gatatgaatgatgggcgagtgcgtgctataaaactgaagcttattgaagccgggatggcc
caccgtgtcctattgatgtcctacagcgccaaatttagcggttgtttgtacggccctttc
cgtgatgcagcggggtcctgcccatcattcggggatcgcagatgctaccagttaccaccc
ggaggccgtggacttgctcggcgcgctatacagagagatataggcgaaggggcagacatc
ataatggtaaagccggcgagcagctacctggacattatcagagacgcaaaagaaattgcc
aaagacattcccattgctgcttaccaggtcagcggtgagtatgctatgatacatgctggt
gccaaggcgggcgtatttgacttgaaatccatggcctttgaaagtactgaagggattata
agggctggtgctgggattatagtaagctatttcgtgcctgattttctagattggctttcg
aaatga

DBGET integrated database retrieval system