KEGG   Aspergillus flavus: AFLA_090240Help
Entry
AFLA_090240       CDS       T01090                                 

Definition
(RefSeq) endo-1,4-beta-xylanase (XlnA), putative
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     AFLA_090240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_11
Motif
Other DBs
NCBI-GeneID: 7917023
NCBI-ProteinID: XP_002380844
UniProt: B8NKE9
Position
Unknown
AA seq 286 aa AA seqDB search
MTPHTWHLLLIQVAEGMCRTGGETCINASQFHNKPTLYLIAVTHNQRTLAQSHNMVSFSS
ILLACSAAIGALATPIEPLADHPNEAFNETAFNDLVGRSTPSSTGYNNGYYYSFWTDGGG
DVTYTNGNGGSYSVQWSNVGNFVGGKGWNPGSSRAITYSGSFNPSGNGYLAVYGWTTDPL
IEYYIVESYGTYNPGSGGTYKGQVTSDGGTYNIYTSVRTNAPSIIGTATFTQFWSVRTSK
RVGGTVTTGNHFNAWAKYGLTLGTHNYQIVATEGYQSSGSSAITVY
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgactccccacacttggcacctgttgttaatacaggtagcagagggtatgtgccggact
gggggggaaacatgtataaatgccagtcaattccacaacaagccaacattgtatctcatc
gcagtcacacacaaccaacgaactctagcacagtcacataacatggtgtccttctcctcc
atccttctggcctgctccgccgcaattggggcgctagcaactccaattgagccactcgca
gaccatcccaacgaggccttcaacgaaacagcattcaatgacctcgtgggccgctccaca
cccagtagcacgggctataacaatggctactactactccttctggaccgacggcggcggt
gatgtgacttacacaaacggcaacggcggttcatacagcgtgcaatggtccaacgtcggc
aacttcgtcggcgggaaaggatggaaccccggaagctccagagcaatcacctactccgga
agcttcaaccccagcggaaacggctacctagctgtgtacggctggaccactgaccccctg
attgaatactacatcgtcgagtcgtacggcacatacaaccccggcagcggcggcacctac
aagggccaggttacctccgacggaggcacatataatatctatacctctgttcgaactaat
gcaccatctatcatcgggacggcgacctttacgcagttttggtctgtgaggacttcgaag
cgtgtgggaggcacggtcactaccgggaatcatttcaatgcgtgggctaagtatgggttg
accttggggacgcataattatcagattgtggctacggaggggtatcagagtagtgggtct
tctgctatcactgtttattga

DBGET integrated database retrieval system