KEGG   Aspergillus flavus: AFLA_091190Help
Entry
AFLA_091190       CDS       T01090                                 

Definition
ubiquitin C-terminal hydrolase, putative
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
afv  Aspergillus flavus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 572 aa AA seqDB search
MASIPVIVKHQGKRHEVELDLSSNGETLKYQLYSLTGVEPERQKILVKGGQLKDETPLSS
LNAKPGQTFMMMGTPSGGQGSGDLGRPKEAVKFLEDMTEAEAARAEGAIPAGLQNLGNTC
YLNSTLQTLRSVPELHQELLRYRPSTGAAGASNLSDLSSFGLGGLGASMDLTSSLRDLFK
QMSETQEGFPPLMFLNALRNVFPQFAQRDRNGHGYAQQDAEEAWSQIVTQLRNKLMIKEG
EGESSNEVSFVDKYLAGRFESVTECDEPGAKEAGEQPTPSSDVFYKLDCHIGKETNHLHD
GIKAGLEEKIEKRSPTLDRDAIYTKRSRIARLPKYLTVHFVRFFWKRETQKKAKIMRKVT
FPAELDAVDFCTDELKKELIPIRDKVREIRKEELDVERARKRQKLDHQRDEEKKTEAEPE
PLEPMQKKKAAEERKDASKATEKDGDSAMTDVFKSDAEYEAEKAASILAAKKELSELIDP
KLRSDEGTNKSGLYELRGVITHQGASADSGHYTAYVKKQAQGNKEEDGKWWWFNDEKVTE
VEAEKIETLSGGGESHSALILLYRAIDLPTAN
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctataccagttatcgtgaagcaccagggcaaacgtcatgaggtcgagcttgat
ctatcctcgaacggtgaaacgcttaagtaccaattatattccctcaccggcgtggaaccc
gaacgacagaaaattctggtcaaaggaggacaacttaaggatgaaaccccattgtcctcg
ctcaacgccaaaccgggccagacattcatgatgatgggcacgccatctggaggccaagga
tccggggatttgggccgcccaaaagaagcagtgaagttcttggaggacatgacggaggct
gaggctgcaagagcagagggagctattcctgctggccttcagaaccttggtaacacttgc
taccttaactctacactgcagacattgagaagtgttcccgagctccatcaggagcttctg
agatatcgcccctcaacaggtgctgctggagcatcgaacctctcggatctcagcagtttt
ggtcttggtggcctcggcgcctcaatggatcttacgtcttcgttgcgggatctattcaag
caaatgtctgaaacgcaagagggatttccgcctcttatgttcctgaatgctttgaggaat
gtgtttccccagttcgcccagagagatcgaaacggccatggttatgcccagcaagatgct
gaagaggcatggtctcaaatcgtaacccaactgcggaacaagctgatgatcaaggagggt
gagggtgagtccagcaatgaagtatcttttgtggataaataccttgctggaaggtttgag
tctgttacggaatgtgatgagccgggagcaaaagaggctggcgagcaacccaccccaagc
tcggacgtcttctacaagcttgactgtcacatcggcaaagaaacaaatcacttgcatgat
ggcataaaagccggtcttgaagagaagattgaaaagcgttcccctactctagaccgtgat
gccatttacaccaagcgttcacgcattgctcgattgcccaaatacttaactgtgcacttc
gttcgtttcttttggaaacgcgaaacccagaagaaggccaagatcatgcgtaaggttaca
ttccctgccgagttggacgcggtagacttctgcacagatgagctcaaaaaggaacttatc
cctattcgagacaaagtacgggagatccgaaaggaagaactcgatgttgagcgtgctcgc
aagcgtcagaagcttgaccaccagcgggatgaagagaagaaaaccgaagctgaacctgag
cctttggagccaatgcagaagaagaaagccgccgaagaacgcaaagatgcatcaaaggct
accgagaaggatggtgattccgcaatgactgacgtcttcaagtccgatgcagagtatgag
gctgagaaggcagcttctatccttgcagcaaagaaggagctttccgaacttatcgacccg
aagcttcgctccgacgagggtactaacaagtcaggcctttacgaactacggggagtaatc
acacatcaaggtgccagcgctgacagtggtcactacactgcatatgtcaagaaacaagcc
caaggtaacaaggaagaggatggaaagtggtggtggtttaacgatgagaaagtgactgaa
gtggaagcggagaagattgagactctttctggcggcggcgagtcccattctgcgttgatt
ctcctctatcgcgcgattgacctgcctactgcgaattaa

DBGET integrated database retrieval system