KEGG   Aspergillus flavus: AFLA_091910Help
Entry
AFLA_091910       CDS       T01090                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
afv  Aspergillus flavus
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:afv04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 396 aa AA seqDB search
MATGTVDPSAPKDVQGTSAPAGDIDTGSGNLHEKEKQMVSAIRPPHQRHLSPFVITERPE
EKQLGVSTRTLTVDDFALLKTLGTGTFARVWLVRLKDEIRQRDKVYALKILRKADVIKLK
QVEHVRNERKTLSAVAGHPFITTLIASFSDDQSLYMLLDYCPGGEIFSYLRRARRFNENT
AKFYAAEITLTIEFLHDVEGIVYRDLKPENILLDAEGHIRLVDFGFAKKVDNRETYTLCG
TPEYLAPEVIHNSGHGLAVDWWALGILIYEFLVGQPPFWDQNPMRIYEQIVEGRIRFPQN
MSPAAQNIISLLCKTNPTERLGYISGGSARVKSHPFFEDIQWDDLFYRRIKGPIIPRVDH
PADTGNFEEYPDPDVRSQNVYTDDLKKKYEALFSDF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctacaggaacggtcgacccttcggcccctaaggatgtccaggggacctcggccccg
gccggagacatcgatacggggtcaggtaatcttcacgagaaagaaaaacaaatggtgtct
gctatccgcccgccgcaccagcgacatctgagtcctttcgtcatcaccgagcggccggag
gaaaagcaactgggtgtgtctacccgcaccttgacagttgatgactttgcccttttgaaa
accctcggtactggcactttcgctcgagtatggctagtgagattgaaggacgaaatacgt
cagagagataaagtgtatgcactcaaaatactacggaaggcggatgtgatcaaattgaag
caggtcgaacatgtgcgcaatgagcggaagactctctcggcggttgccggccaccctttc
ataacgacactgatagcctcattttccgacgaccaaagtctgtacatgttgttggactat
tgccctggcggtgagatctttagttacctacggcgcgcgcgccggttcaacgaaaatacc
gctaaattctatgcggccgagataactcttaccatcgaattcctccacgatgtagaggga
atcgtttatcgcgacctgaagcctgaaaacattcttctggacgccgaggggcacattagg
cttgttgactttggctttgcaaagaaagtcgataatcgggagacatataccctttgcggc
acgccagagtaccttgcccctgaggtcatccataacagtggccatggccttgcagtggac
tggtgggccctaggtattctcatttacgagtttctcgtggggcaaccgcccttctgggac
cagaatcccatgcgtatatacgaacagatcgttgaaggccgcatacgcttccctcagaat
atgtcgccggcggctcagaatataatatccttactttgcaagaccaatccgacggagcgc
ctagggtacatatctggagggtctgccagagtcaagtcacatccattctttgaagatata
caatgggatgatctgttttaccgccgtatcaaagggcccatcatcccgagagtcgaccac
cccgcagacaccggtaacttcgaagagtatcccgatccggatgtgagaagtcaaaacgtt
tataccgatgatctgaagaaaaagtatgaggctttgtttagcgacttttag

DBGET integrated database retrieval system