KEGG   Aspergillus flavus: AFLA_092360Help
Entry
AFLA_092360       CDS       T01090                                 

Definition
histone deacetylase RpdA/Rpd3
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AFLA_092360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 685 aa AA seqDB search
MTSLAPLDPINANGSDRGKKVAYFYDSDVGNYAYVSGHPMKPHRIRMTHSLVMNYGLYKK
MEIYRAKPASKYEMTQFHTDEYIDFLSKVTPDNMDTYAKEQSKYNVGDDCPVFDGLFEFC
GISAGGSMEGAARLNRNKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRFKQRV
LYVDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGQGKYYAVNFPLRD
GIDDVSYKSIFEPVIKSVMEWYRPEAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNFIKS
FNLPTLILGGGGYTMRNVARTWAFETGILVGDPLGSELPYNDYYEYFAPDYELDVRPSNM
DNANTKEYLDKIRAQVVENLKRTSFAPSVQMTDVPRDPLVEGMDDEADAILDDLDEDENK
DKRFTKRRFDQYVEKPGELSDSEDEEENAANGVRRQPGIMKRRNQVNYRNLDVESGLESG
MATPADASSVPDDDMDTTADAKMGDAPQTETEAPATPSVAEPPSRAEEASAAVPTEMAID
GQEQAAPSAPISRQPSPKAQDEDITMEDAGNAAPETEQQEQSVAPSEAQAEEKKPAEEKP
ATDKPATEPSSPADAQAPQKESVEDSGPAEASEVAETVEITETKEKSPEAPKDVPEPAKA
EQESPKEVKESTGEPQEKEPTKSEA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgacttccttagctcccttggacccgatcaatgccaacgggtcagaccgtggcaagaag
gtcgcatatttctacgactccgacgttggtaactatgcctacgtctcgggacacccaatg
aagcctcatcgcataaggatgacacatagcttggttatgaactacggtctctataagaaa
atggaaatctatcgcgcaaaaccagcgtctaaatacgagatgacccaattccacacggat
gaatatatcgacttcctttctaaagtaacgccggataacatggacacctacgccaaggag
caaagcaagtataatgtcggtgatgattgtcctgttttcgacggtctttttgaattctgc
ggaattagtgcaggaggtagtatggagggcgcggcccgacttaatcgcaataaatgcgac
attgctgtcaactgggctggtggtcttcaccatgcgaagaagagtgaagcaagtggtttc
tgctacgtgaacgatattgtgctaggcattcttgagttgttgcgcttcaagcagcgagtg
ctgtacgtcgacattgatgtacatcatggtgatggtgttgaagaagccttctacactaca
gatcgtgttatgactgtctctttccacaaatacggagagtacttcccaggaactggcgag
ctccgcgatatcggtgtaggccagggtaaatattacgccgtaaactttccactccgcgat
ggtatcgacgacgtttcttataagagtatttttgagcccgtcatcaagagtgttatggag
tggtaccgaccagaagcagtggttctccaatgcggtggtgacagtctttccggggaccgt
ttggggtgcttcaaccttagtatgagaggacatgccaactgtgtgaacttcatcaagagc
tttaatctacccaccttaattcttggaggaggaggttacacaatgcgcaacgttgcgcga
acctgggcatttgagactggtattcttgttggggatcctttgggctccgagcttccctac
aatgattactacgagtactttgctccggattatgagctggatgtgcggccatcaaatatg
gataacgccaacacgaaagagtatctagataagatccgtgcgcaagttgtcgagaacctt
aagcgaacttcgtttgcaccttccgtacagatgacggacgtaccacgcgaccctcttgta
gaaggcatggatgatgaagcggatgcaatcttggacgatctggatgaggacgaaaataaa
gacaagcgtttcaccaaaaggcgattcgatcaatatgtcgagaaaccaggtgaacttagt
gatagcgaagacgaagaagagaacgctgccaacggagtccgccgccaacctggcataatg
aaacggaggaaccaagtcaactatcgcaaccttgatgttgaatctggacttgagagcgga
atggctacccccgccgatgcttcttcggtacctgacgatgacatggatactaccgccgac
gcgaagatgggcgatgccccacagactgaaaccgaggcacccgcaacaccttccgtcgcc
gagccaccatcaagggctgaggaggcatccgcagcagtaccaacggaaatggcgattgat
ggtcaagagcaagcagctccctctgcgcctatttctcgccagccgtcccccaaggcacag
gatgaagatatcaccatggaagacgcgggcaacgctgcgcccgaaacagagcagcaggag
caatccgtagcgccaagtgaggcccaggcagaagaaaagaagcccgctgaagaaaaacca
gctacggacaaacctgcaacagagccgtcctctccagccgatgcacaggcccctcagaag
gagtccgtagaggactcagggccagctgaagcaagtgaggtagcggaaacagtagagata
actgagaccaaagaaaagagcccagaagctcctaaggatgtgcctgagccagccaaagca
gagcaggaatcacccaaggaagtaaaggaatcaactggtgaacctcaagagaaggagccc
accaagagcgaggcatag

DBGET integrated database retrieval system