KEGG   Aspergillus flavus: AFLA_093140Help
Entry
AFLA_093140       CDS       T01090                                 

Definition
histone H3 methyltransferase, putative
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
afv  Aspergillus flavus
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:afv00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 502 aa AA seqDB search
MGFFDHLQKGGGFSLQPKKPQIRKVVQARPAPPSRASSLTPGTSSRASPSDKPKKTQGSG
SRSVSKDPDLTSSKRRLNAPSQNRKRQTPEQRLSSDDDSSDTDTSFEVRKRARTGDSAEP
DFERRLRSLKAFSEGGVKSLPIVHAADITSVQKAGCFKPAFGGTGRPTEIFLQYPSASPK
ERYNLVVPRDKDDFRPIDDIFQVIETVSQNYIPEDEADYFDNESTGIKRRLRRALAHASE
AEFRNVVTDYNDAIERLRRDGSIAQKLDSTHRLNLPLVERILTQIYSRTVSPRVESLRQY
ENGTDNVYGELLPRFISTIFKETGLKSGQVFVDLGSGVGNVVLQAALEIGCESWGCEMMQ
NACELAELQQTEFRARCRLWGIAPGKTHLVRGDFLKEQSIIDVLKRADVILINNQAFTPQ
LNNELINHFLDMKEGCQIVSLKSFVPAAHKIQSRNLNSPINLLKVKQREYWSNSVSWTDV
GGTYFIATKDSSRLRAFAESMG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgggattctttgaccacctccagaaaggagggggcttctctctacaaccaaaaaagcct
cagatccgtaaagttgttcaagcacggcctgcgcctccttcaagagcgtcatcactgacc
ccgggtacatcgtcgcgtgcctcgccctctgacaagccgaagaagacgcaaggatcgggg
agcaggtcagtctcgaaagatccagaccttacatcttcgaaacggcgattgaacgctccg
tcacagaatcgaaagcgacaaactccagaacagcgactttccagtgatgatgattccagt
gacacagatacgtcgttcgaagttcgtaagcgcgcgagaacaggcgacagtgcggagcca
gattttgagaggcggctacgttctttgaaggcgttctcagaaggaggagttaagtcattg
ccgatagtacatgcagccgacatcacatctgtccaaaaggcggggtgtttcaaaccagct
tttggaggcacgggccggcctacagaaatattcttacagtatccgagtgcttccccgaaa
gaaagatacaaccttgttgtaccccgtgacaaagacgattttagacctattgacgatatt
ttccaagtcatcgaaactgtgtcccaaaattacataccggaggacgaggcggactatttt
gataatgagtcaaccgggattaagagaagactacgacgagcgctcgcccacgcatccgaa
gcggagtttcgaaacgtcgtaacggattataacgatgcgatcgaacgattaagacgcgac
ggcagcatcgcacaaaaactcgactcgactcatcggttgaatttacccctcgtcgagaga
atcttaacccaaatttattcgcgcactgtgtcacctcgggttgaatcactccgtcaatat
gaaaacggaacggacaacgtttacggagaattactacctcgtttcatcagcaccatcttc
aaagagacaggattgaagtcgggtcaggttttcgtcgatctaggatctggcgtgggtaac
gttgttttgcaggcggcactggagattgggtgtgaaagctggggctgcgaaatgatgcag
aatgcgtgtgaacttgccgaactccagcagaccgagttcagggctcgatgtcgcctatgg
ggaattgcacctgggaaaacacatctcgttcggggggatttcctcaaagaacaaagtatc
atcgatgtcctaaagcgcgcagatgtcatcctgattaacaaccaggctttcactccacaa
ctcaataacgagttgatcaaccacttcctggacatgaaagagggttgccagatcgtgtcc
ctcaagtcatttgtccctgcagcccataagatccagtctcggaatctaaactcgcccatt
aatcttctcaaggtaaagcagagggaatattggtccaacagtgtcagctggaccgacgtt
ggtggcacttacttcatcgctaccaaagacagctctaggttgagagcttttgcagagagc
atgggttga

DBGET integrated database retrieval system