KEGG   Aspergillus flavus: AFLA_093280Help
Entry
AFLA_093280       CDS       T01090                                 

Definition
disulfide isomerase (TigA), putative
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
afv  Aspergillus flavus
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:afv04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 366 aa AA seqDB search
MARLSYLLVSCLSVVSAASAVVDLVPKNFDNVVLKSGKPALVEFFAPWCGHCKNLAPVYE
ELGQAFAHAEDKVTIGKVDADEHRDLGKKFGIQGFPTLKWFDGKSDKPVDYNGGRDLESL
SSFVSEKTGIKPRGPKQEPSEVEMLTDSSFKTTIGGDKDVLVAFTAPWCGHCKNLAPTWE
SLAKDFVLEPNVVIAKVDAEAENAKATAREQGVTGYPTIKFFPKGSKEGIAYSGARSEEA
FVEFVNEKAGTHRAVGGGLDDRAGTIASLDELVAKYTSSQNVEELLGEVKKAAKGLQDKY
AQYYVKVAEKLSQNKEYADKEFARVKKIIAKGGSAPEKVDDLISRSNVLRQFLSQEKADM
DMKDEL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtctgagctacctgctcgtgagctgccttagcgtcgtgagcgctgcttccgca
gtcgtcgatctagtccccaagaacttcgacaatgtcgtgctcaagtccggcaagcccgcc
ctcgttgaattcttcgccccctggtgcggtcactgcaagaacctggcgcctgtgtacgag
gagcttggacaagctttcgctcacgccgaagacaaagttaccatcggcaaggttgatgct
gacgagcaccgcgatctcggcaagaagttcggtatccagggattccctactttgaaatgg
ttcgatggcaagagtgacaagcctgtggactacaatggcggtcgtgatctggagagtctg
tctagcttcgtgtcggaaaagacgggcatcaagcctcgtggccccaagcaggagcccagc
gaggttgagatgctgactgattcctctttcaagactactatcggaggtgacaaggatgtt
ctggttgctttcaccgccccttggtgtggacactgcaagaacctcgcccctacctgggag
tccctcgctaaggacttcgtcctcgagcccaacgttgtgatcgccaaggttgatgctgaa
gctgagaacgccaaagccactgcccgggagcagggtgtcaccggatacccgaccatcaaa
ttcttccccaagggctccaaggagggtattgcctactctggcgctcgctccgaggaggcc
ttcgttgagttcgtgaacgagaaggctggcactcaccgcgccgtcggaggcggtctcgat
gacagagctggcaccattgcctccctcgacgagctggtcgccaagtacacctcctcccag
aacgttgaggagctcctcggtgaggtgaagaaggctgccaagggcctgcaggacaagtac
gcccagtactatgttaaggttgccgagaagctcagccagaacaaggagtatgccgacaag
gaattcgctcgtgtgaagaagatcatcgccaagggcggttcggcaccggagaaggtcgac
gacctcatctcccgtagcaatgttctgcgccagttcctgagtcaggagaaggccgatatg
gacatgaaggatgagctgtaa

DBGET integrated database retrieval system