KEGG   Aspergillus flavus: AFLA_093760Help
Entry
AFLA_093760       CDS       T01090                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
afv  Aspergillus flavus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:afv00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFLA_093760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 795 aa AA seqDB search
MDLQSTYFNIVRPLIKSQTGGSRTSVANSSLSAFEDSVLSNLSIVPALCLYCSTAHQQLT
ITSMVLLEKLSSSTKLNKVSSPGLAKWRSSNKIVEVLSTEVEVDSVARPLVSQMQPEVRE
LDHGSQSSGYIIRESLLALLNSCLRMITDRPTIAHLLLGFSSVGNMLDISSDGLLANGMS
LLHAIITFLQSYPDQVDGNILSWMVHLKRMALEVLKHLWSSRISSYFTLTEMRASRFLQS
LLASQPIIGPNTPWDGFPIMTEEFWISDSASALAEFLLFRSYLYAYATTEVRSAAKLRSP
TLQADIMSTLFGNSTSETGDAVLNPTVFDLFDFADLDIGRQLQPPMLVLLDGIMLEACAK
EADDSLVLYSEAELEELIQLRKEELLSSGHLRPQDEEQFLAEAEGLKIFVHATNQSRKIN
NNRYLALRSWTELITTMLTCSEIEGGRKSTFILHTIQLILPKLEAAVEEDLPEATELARL
AEVLVTKLESSATKANSARRSGDVIDEKLHQLFQICVRGIALATGNVNLRETFYNICSSY
IARIIQPDTGHESIKQHSHQIVKMAGTTLIEAICDDAYAGQETCRVSALLFLNLLAALDK
QGDSILAESISQSNYLSLFLDAIRTLPIELRNAQANDTPLLLSYYESLLSLLQQLCQTKA
GATHVLKTGLFEAVRGSQLFAADPDLGIDIDNPDALRRYYDLLDSVLRVIVSAAFSRGLH
NEQMMEQTRAFLAENRQSMVGIFKRFAKIGGGGAADHHNALTNLTKSYMALVAATDFLEF
EDNEVRELAQPKLFS
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggaccttcagtcgacgtatttcaacattgttcgccccctgatcaagtctcaaactggt
ggaagccgaaccagcgtagcaaactcatcgctctcggcctttgaagatagcgtcctcagc
aatttgtcaatcgtaccagctttgtgtctttattgcagcacagcacatcaacaactcaca
atcacatctatggtgctgctggagaaactttctagctctacaaagctcaacaaggtttca
tcacccggattagccaagtggcgctcctcaaataaaatcgttgaggtcctgagcactgaa
gtagaggtggacagcgtggcgcgcccgcttgtatctcaaatgcagcctgaagtacgggaa
cttgatcatgggtcgcaatcttcgggttacattattagagaaagtttattggcgctgctg
aatagctgcctaagaatgattacagatcggcccacgatagctcatcttcttcttggattt
agcagcgtgggaaatatgctcgacatctcctctgacggacttctcgccaacggaatgtct
ttgctacacgctatcatcacattcttgcaaagctatccagaccaagttgatggaaatatc
ctgtcatggatggtgcacctgaagcgtatggcattggaggtgttaaagcatttatggtca
tctagaatctcttcctacttcacccttactgagatgcgtgcgagtcgtttcctgcaaagt
ctgcttgcaagccaacccatcattggaccaaatactccttgggatgggttcccgattatg
acggaagagttctggatttcggattcggctagtgctctcgcagaatttctgttgttcaga
agttatttgtatgcttatgctactacagaggttcgctcggctgctaagctccgttcacca
acgctgcaagcagatatcatgtcgacattgtttggaaattcgacctccgagacaggggat
gccgtcttgaatcctacggtgtttgaccttttcgatttcgcggatctggacattggacgt
caacttcagccccccatgctggtcctactagatggtattatgctggaggcgtgtgcaaaa
gaggcggatgattcacttgtcctttacagtgaggcggagctggaggagctgatacaactc
aggaaagaagagttgctttcaagcggacatttacgccctcaagacgaggaacaatttctt
gcagaagccgaaggtctgaagatattcgtccatgcgacaaaccagtcaaggaagatcaat
aacaaccgttatctggctctccgatcctggacggaactcattacgacaatgctcacttgc
tccgaaattgaaggtggacggaaatcgacattcatactgcataccattcaattgattctt
cccaagcttgaagccgctgttgaagaggatcttcctgaggcgaccgaactagcacgctta
gctgaagttttagttacaaaactggaatcaagtgcaacaaaagcaaattcggcccggaga
agtggggatgtcatcgatgagaagctccatcaactcttccagatctgtgttagaggtatc
gctctggcgacaggaaatgttaatctccgagaaactttctacaacatatgctcatcctac
atcgcccgtatcatccagcccgatacaggacacgagagtatcaaacagcatagccatcag
attgtcaagatggctggcaccacactgattgaagcgatatgcgatgatgcatatgctggt
caggagacatgtcgcgtgtctgctctattgttcctcaatctccttgcagccctcgataaa
cagggtgattcaatattggctgagtcaatttcccagtcaaattacttaagtctcttcctc
gatgccattaggacgttgcccattgaactcagaaatgcccaagcgaatgatacaccttta
ctcttatcctattacgaatccctgctatctttgcttcagcaactctgccaaacgaaggcg
ggcgcaacccatgttctgaagaccggtctttttgaagcggtacgtggttcgcagctattc
gctgccgacccagatcttggcattgatatcgataaccccgatgctctccggaggtattac
gatctactggattccgttctacgagtaattgtttccgccgcgttttcccggggcctgcac
aacgagcaaatgatggaacagactcgtgcgttccttgctgagaataggcaaagtatggtc
ggcatattcaaacgctttgccaagatcggtggagggggtgctgccgatcaccataacgcc
ctgaccaacctgaccaaatcatatatggcactagttgctgctacggatttcttagagttt
gaggataacgaagtgagagagctcgctcagcccaaattattctcgtga

DBGET integrated database retrieval system