KEGG   Aspergillus flavus: AFLA_099500Help
Entry
AFLA_099500       CDS       T01090                                 

Definition
(RefSeq) MAP kinase SakA
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
afv  Aspergillus flavus
Pathway
afv04011  MAPK signaling pathway - yeast
afv04139  Mitophagy - yeast
afv04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:afv00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AFLA_099500
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    AFLA_099500
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    AFLA_099500
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AFLA_099500
Protein kinases [BR:afv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   AFLA_099500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 7919861
NCBI-ProteinID: XP_002383823
UniProt: B8NTM0
Position
Unknown
AA seq 337 aa AA seqDB search
MMNPFANASIAKRTYREVKLLKQLRHENLIGLCDIFISPLEDIYLVTELLGTDLGRLLRA
RPLDNKFAQYFMYQILVTSRKSISNLLQRGLKYIHSAGVIHRDLKPSNLLVNENCDLKIC
DFGLARVQEPQMTGYVSTRYYRAPEIMLTWQRYGKMVDIWSAGCILAEMLRGKPLFPGKD
HIHQFFLITEVLGNPPPEVVQKITSGNTQRVVNSLPNQEPRPLRAVFHEFDNDVISLLEQ
LLLFDPDKRLTAETALQHPYLAPYHDPDDEPAALEKFDWSFNDADLPIDTWKLMIYSEVL
DYHSLGSAGALDLGPGIEEPTLDPTLDPTFDFLQADI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacccctttgccaacgcttccattgccaagcggacgtacagagaggtcaaactt
ctgaaacagttgcgccatgagaatcttattggcctgtgcgatatctttatctctccacta
gaggacatatacctggtaacggaactcctggggactgatctcggtcgactcttaagggca
aggcccctcgacaataagtttgctcaatacttcatgtaccagatactggtgacgagccga
aagagcatttctaaccttctacagcgcggactgaaatatatccactctgctggcgtcata
caccgtgatctgaaaccaagcaatctcctggtcaatgaaaactgtgacttaaagatctgc
gacttcggtctagctcgagtacaagaacctcagatgactggttatgtctcgacgaggtat
taccgagccccagagatcatgttgacatggcagagatacggtaaaatggtagatatctgg
agcgcgggctgtattctcgccgaaatgcttcgagggaagccgttgttcccagggaaggac
cacattcaccagttcttcctgatcacagaagtgctcggaaacccgcctccagaggtggtt
cagaaaataactagtggaaatactcagcgggttgtcaattcactaccgaatcaagagcca
cgcccactgagggctgtgttccatgaatttgataacgatgtcatcagtctcctcgagcag
ctgctcttgtttgatccagacaagagactaacagctgagaccgctttgcaacacccctat
ctcgccccttaccatgatcccgacgacgagcctgcagcgctagagaaattcgactggtcg
ttcaatgatgccgatcttcctatagatacatggaaacttatgatatactccgaagtcctt
gattaccacagcctcggttcggctggggcactggatctaggaccggggatagaggaacca
actcttgacccaactcttgatccaactttcgactttctccaggcggatatatga

DBGET integrated database retrieval system