KEGG   Aspergillus flavus: AFLA_100460Help
Entry
AFLA_100460       CDS       T01090                                 

Definition
NADPH cytochrome P450, putative
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
afv  Aspergillus flavus
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:afv00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:afv00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 444 aa AA seqDB search
MAEHGGARLAPRGSADTAEDDPFAELESWSERSVWPGLEAAFNLARHNSSDGTGKSTRIT
IRSPYTLRAAHETAVVHQVRVLTSAETTKKVHVELALPDTMNYRPGDHLAILPLNSRQSV
QRVLSLFQIGSDTILYITSSSATSLPTDTPISAHDLLSGYVELNQVATPTSLRSLAAKAT
DEKTAEYLEALATDRYTTEVRGNHLSLLDILESYSVPSIEIQHYIQMLPLLRPRQYTISS
SPRLNRGQASLTVSVMERADVGGPRNCAGVASNYLASCTPGSILRVSLRQANPDFRLPDE
SCSHPIIMVAAGSGIAPFRAFVQERSVRQKEGIILPPAFLFFGCRRADLDDLYREELDAF
EEQGVVTLFRAFSRAQSESHGCKYVQDLLWMERVRVKTLWGQDAKVFVCGSVRMNEGVKA
IISKIVSPTPTEELARRYIAETFI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacatggtggagctcgtctagccccgcgagggtcggcggatactgcagaagat
gaccccttcgcggaattagagtcatggtcggaaaggagcgtctggcctggtcttgaggct
gccttcaatcttgcgcgccataactcatcggatgggactggaaagagcaccaggataacc
attcgatcaccctacacgttgcgcgctgctcacgaaacagctgtcgttcatcaagttcgc
gtgttgacatccgcggaaaccactaagaaagtccatgttgagctggccctgccagataca
atgaactaccgtcctggtgatcatctagccattttgccccttaactctcggcagagtgtg
cagcgggtactttcacttttccaaatcggttcagataccattttgtatattacttctagc
agtgccacctccttgccgacagatacccctatatctgcccacgacctgttgagcggctat
gtggaattgaatcaagtggctacgcccactagcttgagatcgttggctgcgaaagccacc
gatgagaaaactgcagagtatcttgaagccctcgccacagatcgatacacaacggaagtc
cggggaaaccatttgtccctattggacatattagaaagctattccgtaccctcgattgaa
attcagcattatatccagatgttgcctctccttcggccccgccaatacaccatttcctca
tctccgcgattgaaccgtggccaggcttcattgactgtttccgttatggagagagcagac
gttggcgggcctagaaactgtgctggggtagcatcaaactacctagcgagctgcaccccc
gggtcgatcctccgagtgtctctgcggcaggcaaatcctgacttccgactcccagatgag
tcgtgctctcaccccataatcatggttgccgctggatcaggcattgcacccttccgcgca
tttgtccaggaaagatccgtccgacagaaggaaggaatcatcttacccccggccttcctg
tttttcggttgcaggagagctgacttggatgatctctatcgcgaggagttggatgctttc
gaggaacaaggggtggtaacgctctttagagcttttagcagagctcagagcgagagccat
ggctgcaaatacgtccaagatttgctatggatggaaagagtgagggtgaaaacgctttgg
ggacaagatgctaaggtcttcgtctgcggcagcgttagaatgaatgaaggggtgaaggcg
ataatttcaaagattgtttctcctacaccgacagaagaactcgcgcggcgatatatagct
gagacttttatatga

DBGET integrated database retrieval system