KEGG   Aspergillus flavus: AFLA_100460Help
Entry
AFLA_100460       CDS       T01090                                 

Definition
NADPH cytochrome P450, putative
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
afv  Aspergillus flavus
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    AFLA_100460
  Amino acid metabolism
   00380 Tryptophan metabolism
    AFLA_100460
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AFLA_100460
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     AFLA_100460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 444 aa AA seqDB search
MAEHGGARLAPRGSADTAEDDPFAELESWSERSVWPGLEAAFNLARHNSSDGTGKSTRIT
IRSPYTLRAAHETAVVHQVRVLTSAETTKKVHVELALPDTMNYRPGDHLAILPLNSRQSV
QRVLSLFQIGSDTILYITSSSATSLPTDTPISAHDLLSGYVELNQVATPTSLRSLAAKAT
DEKTAEYLEALATDRYTTEVRGNHLSLLDILESYSVPSIEIQHYIQMLPLLRPRQYTISS
SPRLNRGQASLTVSVMERADVGGPRNCAGVASNYLASCTPGSILRVSLRQANPDFRLPDE
SCSHPIIMVAAGSGIAPFRAFVQERSVRQKEGIILPPAFLFFGCRRADLDDLYREELDAF
EEQGVVTLFRAFSRAQSESHGCKYVQDLLWMERVRVKTLWGQDAKVFVCGSVRMNEGVKA
IISKIVSPTPTEELARRYIAETFI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacatggtggagctcgtctagccccgcgagggtcggcggatactgcagaagat
gaccccttcgcggaattagagtcatggtcggaaaggagcgtctggcctggtcttgaggct
gccttcaatcttgcgcgccataactcatcggatgggactggaaagagcaccaggataacc
attcgatcaccctacacgttgcgcgctgctcacgaaacagctgtcgttcatcaagttcgc
gtgttgacatccgcggaaaccactaagaaagtccatgttgagctggccctgccagataca
atgaactaccgtcctggtgatcatctagccattttgccccttaactctcggcagagtgtg
cagcgggtactttcacttttccaaatcggttcagataccattttgtatattacttctagc
agtgccacctccttgccgacagatacccctatatctgcccacgacctgttgagcggctat
gtggaattgaatcaagtggctacgcccactagcttgagatcgttggctgcgaaagccacc
gatgagaaaactgcagagtatcttgaagccctcgccacagatcgatacacaacggaagtc
cggggaaaccatttgtccctattggacatattagaaagctattccgtaccctcgattgaa
attcagcattatatccagatgttgcctctccttcggccccgccaatacaccatttcctca
tctccgcgattgaaccgtggccaggcttcattgactgtttccgttatggagagagcagac
gttggcgggcctagaaactgtgctggggtagcatcaaactacctagcgagctgcaccccc
gggtcgatcctccgagtgtctctgcggcaggcaaatcctgacttccgactcccagatgag
tcgtgctctcaccccataatcatggttgccgctggatcaggcattgcacccttccgcgca
tttgtccaggaaagatccgtccgacagaaggaaggaatcatcttacccccggccttcctg
tttttcggttgcaggagagctgacttggatgatctctatcgcgaggagttggatgctttc
gaggaacaaggggtggtaacgctctttagagcttttagcagagctcagagcgagagccat
ggctgcaaatacgtccaagatttgctatggatggaaagagtgagggtgaaaacgctttgg
ggacaagatgctaaggtcttcgtctgcggcagcgttagaatgaatgaaggggtgaaggcg
ataatttcaaagattgtttctcctacaccgacagaagaactcgcgcggcgatatatagct
gagacttttatatga

DBGET integrated database retrieval system