KEGG   Aspergillus flavus: AFLA_103040Help
Entry
AFLA_103040       CDS       T01090                                 

Definition
(RefSeq) protein mannosyltransferase 1
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
afv  Aspergillus flavus
Pathway
afv00514  Other types of O-glycan biosynthesis
afv00515  Mannose type O-glycan biosynthesis
afv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    AFLA_103040
   00514 Other types of O-glycan biosynthesis
    AFLA_103040
Enzymes [BR:afv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     AFLA_103040
Glycosyltransferases [BR:afv01003]
 O-Glycan biosynthesis
  O-linked Man type
   AFLA_103040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT PMT_4TMC MIR DUF2530
Motif
Other DBs
NCBI-GeneID: 7920858
NCBI-ProteinID: XP_002384175
UniProt: B8NV10
AA seq 913 aa AA seqDB search
MSPKSKNALEVQPPTKSTRSSSRSPRPKNRKKAPVETLNYGSDGVKDNSIFSLPTSDYKA
LVLVTLVATAVRLFRIYQPTSVVFDEVHFGGFASKYIKGRFFMDVHPPLAKLLITLAGWL
AGFNGDFDFKEIGKDYLAAGVPYVAMRMLPAIMGVLTVSLMFLTLKASGCRTTTAVLGAG
VVIFENALVTQSRLILLDSPLVFFTALTAMSFTSFTNQQELGPSHAFRGPWWFWLAATGL
CLGATLSVKWVGLFTVAWVGSLTIIQLWVLLGDTNNVTPRLWFKHFFARFFCLIVIPLGF
YCGMFAIHFLCLVNPGEGDGFMSSEFQATLNSKAMQDVPADVAFGSRITLRHHNTQGGYL
HSHNHMYPTGSKQQQITLYPHKDENNVFIAENQTQPLGPDGEIAGPFAWDNITAEYIEDG
AIIRLNHLMTQRRVHSHDERPPVTEADWQYEVSAYGFEGFAGDANDMFRVEIVKSMSEGE
EAKKRLRTIQSKFKLVHVMTGCVLFSHKVKLPDWGWEQQEVTCAKGGTLPNSVWYIESNS
HPMLPADAEKVNYRNPGFLGKFWELQKVMWTTNAGLTESHAWDSRPPSWPTLLRGINFWG
ADHRQIYLLGNPLIWWSSTLAIGIYVLFKGISILRWQRNCADYRNVNFKRFDYEVGTSVL
GWAFHYFPFYLMARQLFLHHYLPALYFAIITLCQEFDFLANRIHALGLASRPAIGKALAG
IFLALSIFTFTLYSPLVYGNPWTQDACRKVKLLDTWDFDCNTFHTDAPPPEAPVAPPPQQ
DQQILKEEAEEADDANVTPEPQPPRAKARVEYRDQDGNILDEKLVAALAKEGKVSFETRH
ETRTRLEHGHEVEMINGQVAPPHPDVEGQNPETLGKQEQSADDGPASAAGDSSAAEPNSP
EAKPASEGNEATN
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccaaatccaagaacgccctggaggtccagcctccaacgaagtctacccgctcc
tcaagtcgctccccgaggccgaaaaaccgcaagaaggcacccgtggaaacgctgaattat
ggttcggatggagtgaaggacaacagtattttcagccttcctacttccgactacaaggcc
ttggttctcgtcaccttggtcgctactgctgtccgtctctttagaatctatcagccgaca
agcgttgtcttcgacgaagtccattttggtggttttgcgtcaaaatatatcaagggccgc
tttttcatggatgttcacccgccactcgctaaacttcttattacacttgcgggttggttg
gctggattcaatggcgatttcgatttcaaggaaattggaaaggactatttggcagcagga
gtcccatatgtggcaatgcgaatgctcccagctatcatgggtgtgcttacggtgtccttg
atgttcttgacgttgaaagcatcgggatgtcgcaccacgactgccgtgctaggtgctggt
gtggtgatattcgagaacgccctggtcacccagtctcgtctgatcctcttagactcgccg
ctggtgttctttactgcactcacggccatgtcattcacatctttcacgaaccagcaagaa
ctaggcccatcgcacgccttccgtggaccctggtggttttggttagctgctactggccta
tgtcttggtgctactttaagtgttaaatgggttggccttttcacagttgcttgggttggt
tctctaaccatcattcaactgtgggttcttcttggggatacaaataatgtcactccgcgc
ttgtggtttaagcatttctttgctcggttcttctgcctcatcgtcattccattgggcttc
tactgtggaatgtttgcaatccatttcctgtgtctggtaaatccgggtgagggcgatggt
tttatgtcgtctgagttccaggctacattaaactcgaaggcgatgcaagatgttcccgct
gacgttgctttcggctcccgtatcacgcttcgtcaccataatacgcagggtggctacctt
cattctcacaaccacatgtaccctacaggaagcaaacaacagcagattacactctatccc
cacaaggacgaaaacaacgtcttcattgcggagaatcagactcaacctcttggccctgac
ggagaaatcgcgggtccttttgcctgggataacattaccgctgagtatattgaagatggt
gctatcattagattgaaccacttgatgactcagagaagagtccattcacacgacgagcgc
ccccccgtgactgaggcggattggcaatatgaagtatctgcctatgggttcgaggggttc
gctggtgatgcaaatgatatgttccgcgtagaaatcgtcaagtcaatgtcagagggcgaa
gaagccaagaagcgcttgaggaccatccaatccaaattcaagttggtgcacgtcatgacc
ggctgcgtcctattctcccacaaagtcaaacttcccgactggggctgggagcagcaagag
gtgacttgcgcgaagggaggcaccttgcccaacagtgtttggtacatcgagtccaacagc
cacccaatgctgccggcggatgcagagaaggtcaattaccgaaaccccgggtttttgggc
aagttctgggaactccagaaggtgatgtggacgaccaacgcgggattgacggagtcccat
gcttgggattcgcgacccccgtcgtggccaacgctgctccgtggcattaatttctggggc
gctgatcatcgccagatctacctccttggcaacccacttatctggtggtcctcgacattg
gcaattggcatctacgtactatttaagggaatctccatccttcgctggcaacgtaattgt
gcggactatcggaacgttaatttcaagagatttgactacgaggttggcacaagtgtctta
ggatgggccttccactatttccccttctacctcatggcccggcaactctttctccatcat
tatcttccagcgctttactttgccattatcaccttgtgtcaagaattcgacttccttgcc
aaccgtatccatgctcttggactagcatccaggcccgccattggcaaggcgttggccggt
attttcctcgcactgagcatcttcactttcacactttattctcctttggtctatggcaac
ccctggactcaagacgcttgccgcaaggtgaaactattggacacctgggatttcgactgc
aacactttccatactgacgcacctcctcctgaggcccctgtagcccctccaccacagcaa
gaccaacaaatcctcaaggaagaagcggaagaagcggacgacgctaatgttaccccggag
ccccagccccctcgtgctaaggcacgggttgaataccgtgatcaggatggcaatattttg
gacgagaagcttgttgccgcccttgccaaggagggcaaagtatcctttgagactcgccat
gagactcgtactcgcttggagcatggccatgaggtcgaaatgatcaatggccaagtagcc
ccaccgcatccagacgttgagggtcagaatcccgagactcttggaaagcaggaacaatct
gcggatgatggtccagcctccgccgcgggggatagctctgctgcggagcctaattctccc
gaagcaaagcccgccagtgaagggaacgaggctactaactaa

DBGET integrated database retrieval system