KEGG   Aspergillus flavus: AFLA_103480Help
Entry
AFLA_103480       CDS       T01090                                 

Definition
MAP kinase kinase Ste7
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
afv  Aspergillus flavus
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:afv00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AFLA_103480
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AFLA_103480
Protein kinases [BR:afv01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   AFLA_103480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 523 aa AA seqDB search
MADQFKARTLKRKNVKGLALNAAPKPLSNPSDGDAQVPGAIGNTDSNRTDTLEIGLEFRL
DLRSEDLITLKELGAGNGGTVSKVMHASTKVVMARKIIRVDAKENVRKQILRELQVGHDC
NSPNIVTFYGAFQNEARDIVLCMEYMDCGSLDRISKDFGPVRVDVLGKITESVLAGLVYL
YEAHRIMHRDIKPSNILVNSRGNIKLCDFGVATETVNSIADTFVGTSTYMAPERIQGGAY
TVRSDVWSVGLTVMELAVGRFPFDASDSSAGDRASAGPMGILDLLQQIVHEPAPKLPKSD
AFPPILHEFVAKCLLKKSEERPTPRELYDKDAFLQAAKRTPVDLQEWAISMMERHNRKSY
LAPPPPKSLKDEKEESPRRSPAPKPALSKSSRTPHYTPTSGEIPVNMVNEMSSHSRHYHV
PPNPSPRPSRSTRSPPTISLEHLSLETKDDDYRSGRRPSRAHLGDPVSALEPPSRQHIAS
RSASSHNMKSRMPLQTSAMPVRAAPPPSGPLPPASVPGTPWQR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccaattcaaagctcgaacgctaaaacgcaaaaatgtcaaaggtctcgctctg
aacgcagcacccaaacccctctccaacccgtccgatggcgacgcccaagttcccggtgcg
attggaaataccgacagcaaccgtaccgatacgctggagatcggactggagttccgcctt
gatcttcgcagtgaggatttgatcaccctgaaagaactaggggcgggcaatggcggtaca
gtctccaaggtcatgcatgcttctaccaaagttgtcatggcccgaaagattatccgtgtc
gatgccaaggagaacgttcgaaaacagatactgcgggagcttcaagttggccacgactgc
aattctccgaatatcgtgaccttctatggagcatttcaaaatgaagccagggatattgtt
ctgtgtatggaatacatggactgtggctctcttgatcgtatatccaaagacttcggtcct
gtccgagtggatgtactaggcaagatcacagagtcagtactggctggtcttgtgtacctc
tatgaagcgcatcgcatcatgcatcgtgatatcaaaccatccaacatccttgtcaattcg
cggggaaacattaaactttgcgatttcggtgtcgctactgagacagtcaattcgatcgcc
gacacctttgtcggcacttcgacctacatggcacccgagcgcattcaaggcggcgcgtat
actgtccgttcggatgtttggagcgtaggcctgacggtcatggaattggctgtgggtcga
tttcccttcgatgcctcagattcttcggcaggagaccgagctagtgctggccctatgggt
atcttggaccttctacaacagattgtccatgagcccgccccgaagcttccaaaaagcgat
gctttccccccgatcctacacgagttcgtcgccaaatgcctccttaagaaatccgaagag
cggccaacgccccgagaattatatgacaaggacgcgttccttcaggctgctaaacgtaca
ccagttgatctccaagaatgggcgattagcatgatggagcgacataaccgaaagtcctat
ctagctcccccaccgcctaagtctctcaaggacgagaaagaagaatcaccgcgtcgtagc
cccgctccaaagccagcacttagcaaatcgtctcgcacaccacactataccccaacatct
ggagagatcccggtgaatatggtcaacgaaatgtcttcccatagccggcattatcacgta
ccgccgaacccatctcctcgcccaagtcggtcgactagatctccgcccacgatttcactc
gaacatctttctctggaaaccaaggatgatgattatcgatcgggacgccgcccctcgcgt
gcgcacttaggagacccggtgtcggcactggagccaccctcgcgtcagcacatcgcatct
cgctcagcgagctcacataacatgaaatcgagaatgccacttcagacatcagctatgcct
gttcgtgcagctcctcctcccagtgggcccttaccaccggcatcagtgccgggaacacca
tggcaacgctaa

DBGET integrated database retrieval system