KEGG   Aspergillus flavus: AFLA_103650Help
Entry
AFLA_103650       CDS       T01090                                 

Definition
aldose 1-epimerase, putative
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
afv  Aspergillus flavus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_103650
   00052 Galactose metabolism
    AFLA_103650
Enzymes [BR:afv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AFLA_103650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
MADEPSVKFTSLGAIIQELNVGGQNIVLGFTKKELYEKYNTPWFGATIGRVANRIKDAKI
QSLNNQEYELEKNNDPNALHGGSRGWGRRHFEGPTLLQRNGKDTLLYTYTSPHLDGGYPG
TVEIKVFYTASKEDNRSVLSIEYEVELVGDECNETIVNVTNHSYFNLTGGETIEGTSAKL
FTQHYLPLDKTGIPFGRIDVHPSKVTEPFTIGPNKEAFDDAFVMDRDVAVIPLDTRERPL
QLLAEFHHPESRINLQVHSTEPAFQFYTGQGTNVGAVDGNPSRGPFSGFCIEPSRFVNAI
NEPDWRHMVVLKKGDKYGSKIVYKTWKDPQ
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgaaccatcagtcaaattcacatccttgggcgcaatcatccaagagctcaac
gtgggtggccagaacatcgtcctgggatttacgaagaaggaactctatgagaaatataac
accccttggtttggcgcgaccatcggtcgtgtagccaacagaatcaaggatgccaaaata
caaagtctcaacaaccaagaatatgaacttgagaagaacaatgaccctaacgcgctgcat
gggggtagccgtggatggggcaggcggcattttgagggccctactttactgcagcgaaac
gggaaagacaccctactctatacctatacgagtccccatcttgatggaggataccctggc
acggtagagatcaaagtcttctacacggcaagcaaagaggacaatcgttcagtgctttcg
atcgagtatgaggtcgagttggtgggtgatgagtgtaacgagacgattgtcaacgtgacc
aaccatagttatttcaacctcaccggcggtgagaccattgagggcacctcggctaagctc
tttactcaacactatctgccgctcgacaaaaccggcatcccgtttggaaggatcgacgta
catcctagtaaagtcaccgagccattcacgatcgggccgaacaaagaagcttttgacgat
gcctttgttatggatcgagatgtcgctgtgatcccgttggatacgcgtgagagaccgctc
cagctgctcgcagagttccatcacccagagtcgcgtatcaacctacaggtacacagtact
gagcctgcattccagttttatacaggtcaaggaaccaatgtaggtgcggttgacggcaac
ccgagtcgaggcccgttctccggcttctgcatcgagcccagccgttttgtcaatgcgatc
aacgagccggattggcgacacatggttgtcttgaagaagggcgacaagtacggaagcaag
atcgtttacaagacctggaaagacccgcaatga

DBGET integrated database retrieval system