KEGG   Aspergillus flavus: AFLA_103650Help
Entry
AFLA_103650       CDS       T01090                                 

Definition
(RefSeq) aldose 1-epimerase, putative
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
afv  Aspergillus flavus
Pathway
afv00010  Glycolysis / Gluconeogenesis
afv00052  Galactose metabolism
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
afv01130  Biosynthesis of antibiotics
Module
afv_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_103650
   00052 Galactose metabolism
    AFLA_103650
Enzymes [BR:afv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AFLA_103650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 7918980
NCBI-ProteinID: XP_002384235
UniProt: B8NV70
Position
Unknown
AA seq 330 aa AA seqDB search
MADEPSVKFTSLGAIIQELNVGGQNIVLGFTKKELYEKYNTPWFGATIGRVANRIKDAKI
QSLNNQEYELEKNNDPNALHGGSRGWGRRHFEGPTLLQRNGKDTLLYTYTSPHLDGGYPG
TVEIKVFYTASKEDNRSVLSIEYEVELVGDECNETIVNVTNHSYFNLTGGETIEGTSAKL
FTQHYLPLDKTGIPFGRIDVHPSKVTEPFTIGPNKEAFDDAFVMDRDVAVIPLDTRERPL
QLLAEFHHPESRINLQVHSTEPAFQFYTGQGTNVGAVDGNPSRGPFSGFCIEPSRFVNAI
NEPDWRHMVVLKKGDKYGSKIVYKTWKDPQ
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgaaccatcagtcaaattcacatccttgggcgcaatcatccaagagctcaac
gtgggtggccagaacatcgtcctgggatttacgaagaaggaactctatgagaaatataac
accccttggtttggcgcgaccatcggtcgtgtagccaacagaatcaaggatgccaaaata
caaagtctcaacaaccaagaatatgaacttgagaagaacaatgaccctaacgcgctgcat
gggggtagccgtggatggggcaggcggcattttgagggccctactttactgcagcgaaac
gggaaagacaccctactctatacctatacgagtccccatcttgatggaggataccctggc
acggtagagatcaaagtcttctacacggcaagcaaagaggacaatcgttcagtgctttcg
atcgagtatgaggtcgagttggtgggtgatgagtgtaacgagacgattgtcaacgtgacc
aaccatagttatttcaacctcaccggcggtgagaccattgagggcacctcggctaagctc
tttactcaacactatctgccgctcgacaaaaccggcatcccgtttggaaggatcgacgta
catcctagtaaagtcaccgagccattcacgatcgggccgaacaaagaagcttttgacgat
gcctttgttatggatcgagatgtcgctgtgatcccgttggatacgcgtgagagaccgctc
cagctgctcgcagagttccatcacccagagtcgcgtatcaacctacaggtacacagtact
gagcctgcattccagttttatacaggtcaaggaaccaatgtaggtgcggttgacggcaac
ccgagtcgaggcccgttctccggcttctgcatcgagcccagccgttttgtcaatgcgatc
aacgagccggattggcgacacatggttgtcttgaagaagggcgacaagtacggaagcaag
atcgtttacaagacctggaaagacccgcaatga

DBGET integrated database retrieval system