KEGG   Aspergillus flavus: AFLA_103990Help
Entry
AFLA_103990       CDS       T01090                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AFLA_103990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 260 aa AA seqDB search
MIQGSLNAHLVLWKATKKCISMAWYCSGSTNAELVDNLFKAGLVKNERVKNAMLGVDRAH
YAPSRPYSDSPQPIGYGATISAPHMHVHACEYLIDFLRPGSRVLDIGSGSGYLTHVLANL
VTDPSIPDELDGHVIGIDHIPELVDLANKNMHKSDQGCKLLDTGKVKFITADGRLGWPEG
APYDAIHVGAAAEKLHPVLIAQLHAPGRMFIPVDTECDGSPHGFGGGQYIWVVDKREDGS
VHKEKVFQVSYVPLTDPPKK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaggttctctaaatgcacatctagtgctgtggaaggccactaaaaagtgcatc
tcaatggcatggtattgctctggctcaaccaatgcagaattggttgataatctcttcaag
gcgggattggtgaagaatgaaagagttaaaaacgctatgttgggggttgaccgagcccat
tatgcaccttcgaggccttactcagattccccacaacctatcgggtatggtgcgacaatc
tccgctcctcacatgcacgttcatgcatgcgagtacctcatcgatttcctcaggccgggt
tcacgggtactcgatattggctcgggttctggatatctgacccatgtcctcgcaaacctt
gttacagatccctccatacctgatgaattggatggccatgttattggaattgaccatata
ccagaacttgttgacttggctaacaagaatatgcataagtcggaccaagggtgcaaattg
ttagatacaggaaaggtgaagtttattactgctgacggccgtttgggatggccagaggga
gcaccgtatgatgctatccacgttggtgcagcagcagaaaagcttcacccggtactaatc
gcgcaactccatgcccctggccgaatgtttatccccgttgacacggagtgtgacgggagt
cctcatggatttggcggcggccaatatatttgggtagtggacaagagggaggacgggtca
gtccacaaagaaaaggtgttccaggttagctacgttccgctgaccgacccgccaaagaag
taa

DBGET integrated database retrieval system