KEGG   Aspergillus flavus: AFLA_104010Help
Entry
AFLA_104010       CDS       T01090                                 

Definition
dihydrolipoamide succinyltransferase, putative
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
afv  Aspergillus flavus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFLA_104010
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFLA_104010
  Amino acid metabolism
   00310 Lysine degradation
    AFLA_104010
Enzymes [BR:afv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AFLA_104010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 463 aa AA seqDB search
MAFRLPFHRLPEQNLRIIPRYAQSPRNISLGTRRNLTSAALRSCVRNTKRPASCIPQVLG
ANVFRSSFAPLGGYQVRTYADTIVKVPQMAESITEGTLKQFSKQVGDYVERDEEIATIET
DKIDVSVNAPEAGTIKELLVNEEDTVTVGQELAKLELGGAPETKTEEATEKPKEPASTEE
PKAPEPEQPKSAKDSEKPAASEPGSSKQPQPAASKPDIPDDAKPSPGNREERRVKMNRMR
LRIAERLKQSQNTAASLTTFNEVDMSSLMEFRKLYKDDVLKKTGVKLGFMSAFSRACVLA
MKDIPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAETMDLVGIEKAIAD
LGKKARDNKLTIEDMAGGSFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKEKPVAVNGK
IEIRPMMYLALTYDHRLLDGREAVTFLVKVKEYIEDPRRMLLG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcgcttaccttttcaccgtctccccgaacagaatctgcggatcatacctcga
tatgcccaaagccctcgtaacatcagcctgggcacccgcaggaatcttacctcagctgcg
ctccgcagctgtgtcaggaacactaaaaggcctgcttcttgtataccacaggttctgggg
gccaatgtttttcggtctagttttgctccccttgggggctatcaggttcgcacttacgcg
gacaccatagttaaagttcctcagatggcagaatccatcaccgagggtactttgaaacag
ttctccaaacaggtcggggattatgttgagagagacgaggaaatagcaacaatcgagacc
gataagatcgatgtgtcagtcaatgcacccgaagcgggaaccatcaaagagctcctcgta
aacgaggaagacaccgttactgttggacaggaactggcgaagttggagctgggaggtgcg
cctgaaaccaaaacggaggaggcaactgagaagccgaaggagcccgcatctacagaagaa
cccaaagcccccgagccagaacagcccaagtccgcaaaggattctgaaaagcctgccgca
tctgagcctggatcttccaagcagccacagcctgctgcgtctaagccggatattcccgat
gatgctaagcccagccctggaaatcgcgaagagcgaagggtgaaaatgaatagaatgcga
ctgaggatagctgagcgtttgaagcaatctcagaacacggctgcttctctgactacgttc
aatgaggtggatatgtcttctctcatggagtttcggaagttatacaaggacgacgtgctt
aagaagaccggtgttaagctcggcttcatgagcgcgttttctcgtgcttgtgtactagcc
atgaaagacatcccggctgtcaacgcgtcgattgaggggcccaatggtggcgataccatt
gtctaccgtgattacgttgatataagtgtcgctgtcgccaccgagaagggccttgtaaca
ccagtagtgcgcaacgccgaaaccatggatcttgttggaattgaaaaggctattgcagat
ctcggaaagaaggctcgcgacaataagctgaccattgaggacatggcgggtggctctttc
acgatcagcaacggtggcgtcttcggatccctcatgggtacgccgatcatcaacctacca
cagacagctgttcttggactccatgctatcaaagagaaacctgttgctgtgaatggaaaa
attgagatacgccctatgatgtatcttgctctgacctatgaccatcgccttttggatggc
cgggaggctgttactttccttgtcaaggtcaaggaatacattgaggatcctcgccgcatg
cttcttggctag

DBGET integrated database retrieval system