KEGG   Aspergillus flavus: AFLA_104010Help
Entry
AFLA_104010       CDS       T01090                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase, putative
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
afv  Aspergillus flavus
Pathway
afv00020  Citrate cycle (TCA cycle)
afv00310  Lysine degradation
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
afv01130  Biosynthesis of antibiotics
afv01200  Carbon metabolism
Module
afv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFLA_104010
  Amino acid metabolism
   00310 Lysine degradation
    AFLA_104010
Enzymes [BR:afv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AFLA_104010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl HlyD_3 Biotin_lipoyl_2 RnfC_N GCV_H
Motif
Other DBs
NCBI-GeneID: 7919016
NCBI-ProteinID: XP_002384271
UniProt: B8NVA6
Position
Unknown
AA seq 463 aa AA seqDB search
MAFRLPFHRLPEQNLRIIPRYAQSPRNISLGTRRNLTSAALRSCVRNTKRPASCIPQVLG
ANVFRSSFAPLGGYQVRTYADTIVKVPQMAESITEGTLKQFSKQVGDYVERDEEIATIET
DKIDVSVNAPEAGTIKELLVNEEDTVTVGQELAKLELGGAPETKTEEATEKPKEPASTEE
PKAPEPEQPKSAKDSEKPAASEPGSSKQPQPAASKPDIPDDAKPSPGNREERRVKMNRMR
LRIAERLKQSQNTAASLTTFNEVDMSSLMEFRKLYKDDVLKKTGVKLGFMSAFSRACVLA
MKDIPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAETMDLVGIEKAIAD
LGKKARDNKLTIEDMAGGSFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKEKPVAVNGK
IEIRPMMYLALTYDHRLLDGREAVTFLVKVKEYIEDPRRMLLG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcgcttaccttttcaccgtctccccgaacagaatctgcggatcatacctcga
tatgcccaaagccctcgtaacatcagcctgggcacccgcaggaatcttacctcagctgcg
ctccgcagctgtgtcaggaacactaaaaggcctgcttcttgtataccacaggttctgggg
gccaatgtttttcggtctagttttgctccccttgggggctatcaggttcgcacttacgcg
gacaccatagttaaagttcctcagatggcagaatccatcaccgagggtactttgaaacag
ttctccaaacaggtcggggattatgttgagagagacgaggaaatagcaacaatcgagacc
gataagatcgatgtgtcagtcaatgcacccgaagcgggaaccatcaaagagctcctcgta
aacgaggaagacaccgttactgttggacaggaactggcgaagttggagctgggaggtgcg
cctgaaaccaaaacggaggaggcaactgagaagccgaaggagcccgcatctacagaagaa
cccaaagcccccgagccagaacagcccaagtccgcaaaggattctgaaaagcctgccgca
tctgagcctggatcttccaagcagccacagcctgctgcgtctaagccggatattcccgat
gatgctaagcccagccctggaaatcgcgaagagcgaagggtgaaaatgaatagaatgcga
ctgaggatagctgagcgtttgaagcaatctcagaacacggctgcttctctgactacgttc
aatgaggtggatatgtcttctctcatggagtttcggaagttatacaaggacgacgtgctt
aagaagaccggtgttaagctcggcttcatgagcgcgttttctcgtgcttgtgtactagcc
atgaaagacatcccggctgtcaacgcgtcgattgaggggcccaatggtggcgataccatt
gtctaccgtgattacgttgatataagtgtcgctgtcgccaccgagaagggccttgtaaca
ccagtagtgcgcaacgccgaaaccatggatcttgttggaattgaaaaggctattgcagat
ctcggaaagaaggctcgcgacaataagctgaccattgaggacatggcgggtggctctttc
acgatcagcaacggtggcgtcttcggatccctcatgggtacgccgatcatcaacctacca
cagacagctgttcttggactccatgctatcaaagagaaacctgttgctgtgaatggaaaa
attgagatacgccctatgatgtatcttgctctgacctatgaccatcgccttttggatggc
cgggaggctgttactttccttgtcaaggtcaaggaatacattgaggatcctcgccgcatg
cttcttggctag

DBGET integrated database retrieval system