KEGG   Aspergillus flavus: AFLA_104040Help
Entry
AFLA_104040       CDS       T01090                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
afv  Aspergillus flavus
Brite
Exosome [BR:afv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AFLA_104040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 141 aa AA seqDB search
MAPKAAEKKPSTGGKAPAGGKAPAEKKEAGKKTAAAASGDKKKRGKTRKETYSSYIYKVL
KQVHPDTGISTRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGE
LAKHAVSEGTKAVTKYSSSAK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaggctgctgagaagaagcccagcactggcggcaaggcccctgctggcggc
aaggcccctgctgagaagaaggaagctggcaagaagaccgcggctgctgcctctggtgac
aagaagaagcgtggaaagaccaggaaggagacttactcttcttacatctacaaggtcctg
aagcaggtccaccccgatactggaatctccactcgtgccatgtctattctgaactccttt
gtcaatgacatcttcgagcgtgtcgcaaccgaggcctccaaactggccgcttataacaag
aagtccactatctcgtcaagggagattcagacctctgtcagacttatcctgccaggtgaa
ttggcgaagcatgctgtgtcggaaggcaccaaggctgttacgaagtactcctcttctgcc
aaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system