KEGG   Aspergillus flavus: AFLA_105430Help
Entry
AFLA_105430       CDS       T01090                                 

Definition
fatty acid desaturase protein, putative
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
afv  Aspergillus flavus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AFLA_105430
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AFLA_105430
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AFLA_105430
Lipid biosynthesis proteins [BR:afv01004]
 Desaturase
  First
   AFLA_105430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 402 aa AA seqDB search
MKTSAPAGDAGRTFTGELRFYWRHFHVVHFILVAVSPSLIVFGIQQVTLNWKTALWSVIC
YFIYSVAITAGYHRLWCHRSYRASPPLRYVLAALGAGQFQWSIIWWTRHHRAHHRYLDTD
NDPYNARRGLFYSHVGWLIGYNPEMWGSVDISDVVNDQVAVWQRQYYPILAVVIGLLLPS
AVAQIGWNDWQGGFVYAGLTRAYLYGQTTMLVNSLAHWRGGQSFSTTNSARDNLFVALLT
SGEGYHNFHHRFPSDYRNGVHWYSFDPSKWLIWSCARLGLASGLTRSPDREIERAILDVQ
RQQSADSNAGALKRRPSSSVGHHPFPTMDLTEYERQTRTGRCLIIIAGYVCDVTDFIHRH
PGGQWFLQEAIGGDASVAFDSVGHSEEAQEMVRSMQIASVHG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatcagccccagcaggtgatgccggtaggaccttcacgggggagctccgcttt
tattggcggcattttcatgtcgtccacttcatcctcgtagcagtgtcacccagtctgatt
gtctttgggatccagcaggtgacattgaattggaagactgcactatggagtgttatttgt
tattttatctatagcgtagccatcactgccggttaccaccggctttggtgtcaccgatcc
taccgtgcctccccgcctctccgctacgtcctcgctgccctcggggctggacagtttcag
tggtccatcatctggtggacgcgtcatcatcgcgcccatcaccgctacctcgatacggac
aatgacccttataatgcccgacgaggactcttttattcgcacgttggctggttgatcgga
tataaccctgagatgtggggttccgttgatatctcggacgtggtaaatgaccaggtagct
gtctggcagcgtcagtattacccgattctggctgtagtgataggactactactcccatcg
gccgtggctcagatcgggtggaatgactggcagggggggtttgtatatgcaggtcttacc
cgggcatatctttacggacagacgaccatgttggttaactcgctggcgcactggcgcggt
ggacagtcattctccactacaaatagcgcgcgggataatctcttcgttgctcttctaacc
tccggtgaaggttaccataacttccaccatcgatttccgtcagactaccgcaatggagta
cactggtacagctttgaccccagcaaatggctaatctggtcctgtgcgcggttggggctt
gcgtcggggcttacaaggagtccggatagagaaatcgaacgcgccattctcgatgtccag
aggcaacagtcggcggatagcaatgcaggagctcttaaacggcgcccatccagtagtgtg
ggccaccaccccttcccgacaatggatttgaccgagtacgagcggcagacacgtacaggg
cgctgcctgatcataattgcagggtacgtctgcgatgtcactgatttcatacaccgacac
ccgggtgggcagtggtttctccaagaggccattggaggtgacgccagtgttgcctttgat
tccgttgggcactccgaagaggcgcaggaaatggttcggtcgatgcagatcgcctctgta
cacggatag

DBGET integrated database retrieval system