KEGG   Aspergillus flavus: AFLA_106460Help
Entry
AFLA_106460       CDS       T01090                                 

Definition
DNA polymerase delta subunit 4, putative
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
afv  Aspergillus flavus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AFLA_106460
   00240 Pyrimidine metabolism
    AFLA_106460
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AFLA_106460
   03410 Base excision repair
    AFLA_106460
   03420 Nucleotide excision repair
    AFLA_106460
   03430 Mismatch repair
    AFLA_106460
   03440 Homologous recombination
    AFLA_106460
DNA repair and recombination proteins [BR:afv03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      AFLA_106460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 191 aa AA seqDB search
MPPTRRRGGRATATRSNQATLSFGSKSRVTKPSATPTQTQKTKDLEPVIASISEKVPEPE
QVSVTPTEPSQPHVAELAVRQQAQAEIEQPLSKEDEKAIKITEKDLQQYWRKEEEKRRGP
RFHQQDLTLHEKILRHFDLSSQFGPCIGIARLKRWRRANSLNLNPPIEVLAVLLKHKDDI
KQRAYVDELLS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccactcgtcgtcgcggtggccgggccacggccacccgctctaaccaggccacc
ctctcatttggatccaagtccagagtaaccaagccatcggcgacaccgacgcaaacgcag
aagaccaaagaccttgaaccagtcatcgcctctatttctgagaaggtcccggagcctgaa
caagtgtcggttacgcccaccgagccctcgcagccgcatgtggcagagctggccgtgagg
caacaagcgcaagcggagattgaacagccgttgtcgaaagaagacgaaaaggccatcaaa
attactgagaaggacttacaacaatactggaggaaagaggaagagaagagaaggggacct
cggtttcaccagcaagatctcaccctacatgagaagatcctgcgacatttcgatctttcc
agtcaatttgggccttgcattggaattgctcggttgaagcgatggagacgcgcgaattct
ttgaatctcaaccccccaattgaggtcttggccgtgctactcaaacacaaggatgatatc
aaacagagggcatacgttgatgagcttctgtcctga

DBGET integrated database retrieval system