KEGG   Aspergillus flavus: AFLA_106720Help
Entry
AFLA_106720       CDS       T01090                                 

Definition
ceramide synthase membrane component (LAG1), putative
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
afv  Aspergillus flavus
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:afv00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 443 aa AA seqDB search
MARGRSSSNLGADIPGDTSAPAMSTMNEVSPIETEAPKWNKSSEKSLKSQPKRRKSRSLL
RRFKDKCLKHTWLLPLLMVVVLLALYAVNPNPSNPLHSAIFLSYPQGPKTPGGPVMYGKG
PKDVAFVSFYTIVLSFTREFIMQRIIRPWAIYCGIRGKGKTARFMEQVYTAIYFGIFGPF
GLYVMYRSDIWYFNTTAMYEGFPHREHEALFKAYYLLQASYWAQQAIVLLLQLEKPRKDF
KELVGHHIITLALIALSYRFHFTYMGLAVYITHDVSDFFLATSKTLNYLDSFITAPYFGM
FVGIWIYCRHYLNLKILWAVLTEFRTVGPFELNWETQQYKCWISQYITFALLASLQAVNL
FWLFLILRILKNYLFNSIRKDERSDDEDTEEEEEAEQGQSGRATLATGAEVSTVTARNVG
KENQAPQVLVNGEPLNEKSSSRR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcggccggagctcgagtaacttgggcgcggacataccgggtgacaccagcgca
ccagcgatgtcgaccatgaatgaggtcagtccgattgaaacggaggctccaaagtggaat
aagtcttccgagaagtcgctgaagtcgcaaccgaagcgtcgcaagagccgatccctactc
cgccgctttaaagacaaatgcctgaaacatacatggctcctgcctctcctcatggtggta
gttctgctcgccctgtatgcagtcaaccccaacccgtccaatccgctacatagcgcaatc
tttctgtcctaccctcaaggaccgaaaacccctggtggcccggttatgtatggaaaaggt
cccaaggacgttgcctttgtctcgttctacaccattgtcttatccttcactcgggaattc
atcatgcagcgcatcatccggccgtgggcgatatactgcggaatccgcggcaaaggcaag
actgctcgcttcatggagcaggtgtacacagcgatctacttcggcatcttcggtccattt
ggcttgtacgtgatgtaccggtctgatatctggtatttcaacacaacggcgatgtacgag
ggtttcccgcaccgggagcatgaagcgctattcaaggcctactatctgttgcaagcgagc
tactgggctcaacaagccatcgtgctcttactccagctggagaagccccgaaaggacttc
aaagaacttgtcggacatcacatcatcaccttggccctcatcgcgctgagctatcgattc
cacttcacctacatgggccttgcggtctacatcacgcacgatgtttctgatttcttcctt
gcaacttcgaaaacactcaactacctggactcattcattactgcgccatacttcggtatg
tttgttggaatttggatctactgccgccactacctgaacctgaagattctctgggcggtt
cttaccgaattccgaaccgttggtcctttcgagctgaactgggagacccagcaatacaag
tgttggatcagtcaatatatcacctttgccttgctggcgagcttgcaggccgtcaacctt
ttctggctctttttgatccttcgcatcctcaagaactacctcttcaacagtatcaggaag
gatgagcgcagtgatgacgaggatacggaggaagaggaagaagcagaacaggggcaaagc
ggccgtgctactctagcgactggagctgaagtgtccaccgttactgcccgtaatgtcggt
aaggagaaccaggctccccaagttctagtgaacggggagcccctcaacgagaagtcctct
agccgccggtag

DBGET integrated database retrieval system