KEGG   Aspergillus flavus: AFLA_107460Help
Entry
AFLA_107460       CDS       T01090                                 

Definition
mannosyltransferase PMTI
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
afv  Aspergillus flavus
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:afv00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 775 aa AA seqDB search
MSQSPSPSLRKRGGKKEASPGPSEVSSPYPTNQGATPKPQSEWDYRLAITVLTVLAFITR
FYRISYPDEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAAVGWLIGYDGHFLFENI
GDSYIDNKVPYVAFRALPATLGALTVPVVFLIMWESGYSLPACVLAAGLVLFDNAHIGED
RLILLDATLVITMALSILCYVRFYKLRHEPFGRKWWKWLLLTGVSLSCVISTKYVGVFTF
VTIGAAVMVDLWNLLDIRRPAGALSMMEWTKHFAARGFALIVVPFFFYLFWFQVHFAILT
RSGPGDDFMTPEFQETLSDNALAAESIGIQYYDAITIRHKDTKVFLHSHWERYPLRYDDG
RISSQGQQVTGYPFNDTNNQWQILPTVPLEDNEGQGHSVKNGDLVQLLHLGTDSILLTHD
VASPFYPTNQEFTTVTKDVASGERHNETLFEIKIENGKAGQEFRTLSSHFKLIHYPTRVA
MWTHTTPLPEWGFKQAEINGNKNVLQTSNLWYAESIESLEEDSPRKQKEERKVKQLPFLR
KYLELQRAMFFHNNALTSSHPYASEPFQWPFLLRGVSFWTKNDTREQIYFLGNPIGWWIA
SSLLAVFAGVIGADQLSLRRGVDAVEEIWGPGARSRLYNSTGFLFLCWGAHYFPFWLMGR
QRFLHHYLPAHLASCLVTGALIEFIFNLQPVQAVTDSEVDPSGKSKSIRPRHFVTAKERM
SRKSLVACWIATLSILAVTVWGFWFYAPLTYGTPGLDVAGVNARRWLGYDLHFAK
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatccccttcaccgtctctccggaagagaggcggaaagaaggaggcatctcct
ggaccctcagaggtctcctcgccgtatcccaccaaccagggtgcaacccccaagcctcag
tcagaatgggattataggctggccataacggttctgactgtgctggcattcatcacccgg
ttctataggatctcataccccgatgaagttgtcttcgacgaggtgcacttcggaaagttc
gcctcctactacctgcaacgcacgtacttcttcgatgttcaccctccatttggcaagctt
ctcttcgcggcagtgggctggctcatcggctatgatggccatttcttgttcgagaacatt
ggcgactcgtacatcgataacaaagtcccctatgtcgcttttcgcgccttacccgcaacc
ctcggcgcactaacagtccccgtagttttcttgatcatgtgggaatcgggatactctttg
ccagcctgcgttctggccgctggtcttgtgttgtttgacaatgcgcacattggtgaggac
aggttgatccttctggatgccaccttggtcatcacaatggctctgagcattctgtgctac
gttcgcttctacaagcttcgccatgaacctttcggccggaagtggtggaagtggctgctg
ctgaccggtgtgtctctcagctgcgtcatctctacgaagtacgtgggtgttttcaccttc
gtgaccatcggtgctgcggtcatggttgacttgtggaatttgctggatatccgccgtcct
gccggcgctctgagcatgatggagtggaccaagcacttcgcagctcgtggcttcgccctc
atcgtggtgcctttcttcttctatctgttctggttccaggtccatttcgccattttgact
cgctctggtcccggtgacgactttatgacccccgaattccaggaaaccctcagcgacaac
gccctggctgctgagtctatcggaatccagtactatgatgcaatcaccattcggcataag
gacaccaaggtcttcttgcacagtcattgggaacggtacccgcttcgctatgacgatgga
cgtatttccagccagggccagcaggtgacgggatacccattcaatgatacgaacaaccaa
tggcagattcttcccactgtgcccctggaagacaatgagggccagggccacagcgtgaag
aacggcgatctcgtccagctgcttcacttgggtaccgactcgatcctgctgacccatgac
gttgcttcccccttttatccgaccaaccaggaattcacgactgtgaccaaggatgtggcc
agtggtgagagacataacgaaaccttgttcgaaatcaagattgagaacggcaaggccggt
caggagttcagaactctgtcgagtcactttaaactgatccattatcccacccgagtggcc
atgtggacacacacaactcctttacccgagtggggcttcaagcaagccgaaattaatggt
aacaagaacgtccttcagaccagcaatctgtggtacgccgaatcaatcgagtcgctggag
gaagacagccctcgcaagcagaaggaagaacgcaaagtgaaacagctgcccttccttcgg
aagtatctggaacttcagcgcgccatgttcttccacaacaatgccttaaccagcagccac
ccctacgcgagtgagcctttccagtggcccttccttttgcggggtgttagcttctggacc
aagaatgatacccgtgaacaaatttatttcttgggtaacccgatcgggtggtggattgcc
agcagtctgctggctgttttcgctggtgtgattggtgccgaccagctgtctctccgccgt
ggagttgacgccgttgaagaaatttggggacccggtgcccgttcccgcctatacaacagc
accggcttcttgttcctctgctggggagcccactacttccccttctggttgatgggccgt
cagcgtttcttgcatcactaccttcctgctcaccttgcctcctgtcttgtgacaggcgcc
ctgattgagttcattttcaacctccagccggtccaagctgttaccgatagcgaggttgac
ccatcgggcaagtctaagtctattcgtccccgtcattttgttacggccaaggaacgcatg
agccgcaagtccctcgttgcgtgctggatcgccaccctttctattctggccgtcaccgtt
tggggattctggttctatgctcctttgacttacggtactccgggcttggacgttgccggt
gtaaacgcacgtcggtggttgggttatgacctgcacttcgccaaataa

DBGET integrated database retrieval system