KEGG   Aspergillus flavus: AFLA_109190Help
Entry
AFLA_109190       CDS       T01090                                 

Definition
possible replication factor-a protein
Orthology
K10739  
replication factor A2
Organism
afv  Aspergillus flavus
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:afv03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:afv03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:afv03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:afv03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 276 aa AA seqDB search
MDNYGYGSSSYGGGGGFVPGETNSPAAGKSADGNNTTLRPITIKQALDATQPYPEADYQI
DGADVGSICFVGQVRNISTQSTNITYRIDDGTGEIEVKQWVDSATADTMDTDDSKAGAGK
NQVVNNGYAKIFGKLKTFGNKRFVGSHCVRPLTDINELHCHMLEAVAVHLFFTRGPVGGS
GGAGAAAGGAGGADATMGGVDDYSAGRNLPAMSPVARRVYNLLKTEPQSNEGLHAQLIAA
KLSLPMPDVARAGDELLTAGVIFSTVDEQTWAILDY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggataattatggctacggttcttcctcctatggaggcggtggtggcttcgtgccagga
gagacgaacagccccgccgctggaaagagcgcagacggcaataataccacactccgcccc
atcacaatcaagcaggccctcgacgcaacacaaccctatcccgaagccgattaccagatt
gacggcgccgacgtaggcagcatttgcttcgtcggacaagttcgcaacatcagcacccaa
agtacaaacatcacatacagaatcgacgacggcacgggcgaaatcgaagtgaaacaatgg
gttgactctgccacggcagacaccatggacacagatgacagcaaggcaggcgcaggaaag
aatcaggtcgtgaacaacggatatgccaagatattcgggaaattaaagacgttcggaaat
aagcgctttgtaggatcacattgcgtgcggcccttgacagatatcaatgagctccattgc
cacatgctcgaggctgttgctgtgcatcttttctttacccgtggtcctgttggtggctcc
ggtggcgctggtgccgctgctggtggagcaggcggtgctgatgccactatgggtggtgtt
gatgattacagtgctggcagaaaccttcctgccatgagccccgtggcaaggagggtgtac
aatttgttgaagacagaacctcagagcaatgagggtctacatgctcagctcattgcggct
aagctgagtttgcccatgccggatgtcgcccgcgctggtgatgagctgcttacggctggt
gtgattttctcgactgttgatgagcagacctgggctatattggattattag

DBGET integrated database retrieval system