KEGG   Aspergillus flavus: AFLA_109350Help
Entry
AFLA_109350       CDS       T01090                                 

Definition
NADPH cytochrome P450 reductase (CprA), putative
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
afv  Aspergillus flavus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 695 aa AA seqDB search
MAQLDTLDLVVLVALLVGSVAYFTKGTYWAVAKDPYASSGPAMNGAAKAGKTRDILEKME
ETGKNCVIFYGSQTGTAEDYASRLAKEGSQRFGLKTMVADLEDYDYENLDKFPEDKVAFF
VLATYGEGEPTDNAVEFYQFITGEDVAFESGASAEEKPLSALKYVTFGLGNNTYEHYNAM
VRNLDAALQKLGAQRIGSAGEGDDGAGTMEEDFLAWKEPMWTALSEAMGLQEREAVYEPV
FNVTEDESKSAEDETVYLGEPTKGHLEGQPKGPFSAHNPFIAPIVESRELFTVKDRNCLH
MEISIAGSNLTYQTGDHIAVWPTNAGAEVDRFLQVFGLEEKRHSVINIKGIDVTAKVPIP
TPTTYDAAVRYYMEVCAPVSRQFVSSLAAFAPDEATKTEIQRLGSDKDYFHEKITNQCFN
IAQALQSITSKPFSAVPFSLLIEGLNKLQPRYYSISSSSLVQKDKISITAVVESVRLPGA
SHLVKGVTTNYLLALKQKQNGEPSPDPHGLTYAITGPRNKYDGIHVPVHVRHSNFKLPSD
PSRPIIMVGPGTGVAPFRGFIQERAALAAKGEKVGTTVLFFGCRNRNEDFLYQDEFKAYE
EQLGDSLKIITAFSRETSQKVYVQHRLREQAELVSDLLKQKATFYVCGDAANMAREVNLV
LGQIIAQQRGLPAEKGEEMVKHMRSSGSYQEDVWS
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaactcgacactctcgatttggttgtcctggtggcgcttttggtgggtagcgtt
gcctacttcaccaaaggcacctactgggctgtcgccaaagatccttatgcctcttccggt
ccagcgatgaatggcgccgccaaggcaggaaagactagagatatcttggagaaaatggaa
gaaactggcaagaattgcgtcattttctacggttcccagactggaactgcagaggactac
gcctcgagattggccaaggaaggatctcagagattcggtctcaaaactatggttgctgat
ttggaagattacgactacgaaaacttggacaaattccccgaagacaaggtcgcctttttt
gttctcgcgacttatggcgagggcgagcctacggataatgctgtcgagttttaccagttc
atcaccggtgaagatgttgcttttgaaagtggcgcgtccgctgaagagaagccgctgtcc
gctctcaagtatgtcaccttcggcctcggtaacaatacctatgagcactacaacgccatg
gttcgcaatctcgacgccgctctgcaaaagcttggtgctcaacgtattggatctgctggt
gaaggtgatgacggcgctggcacgatggaagaagacttcttggcttggaaggaacctatg
tggaccgcgctttccgaggcgatgggtctccaggagcgcgaggccgtttatgagccggtg
ttcaatgtcacagaagatgagtctaagagcgccgaagacgagacggtctatctcggcgag
ccaactaagggtcatctcgaaggtcaacccaagggcccattctcggcccacaacccgttc
attgcgcctattgtcgagtctcgtgagctattcactgtaaaggatcgtaactgtctgcac
atggaaattagcatcgccggaagcaacctcacctatcaaaccggtgaccacattgctgtt
tggccgacaaatgctggtgctgaggtagatcggttcctgcaggtttttggacttgaggag
aagcgccattcagttattaacatcaagggcattgatgtgactgctaaggttccgatcccg
acccctaccacctatgatgccgctgttcgttactacatggaagtctgtgcccctgtttcc
cggcagtttgtctcgagtctggctgcttttgctcccgatgaggcgaccaagacagaaatt
cagcgtttgggcagcgacaaggattacttccacgagaagatcaccaaccaatgcttcaat
attgcccaggctctccaaagcatcacgtccaagcctttctctgccgttccgttctcattg
ctcatcgaaggcctcaataagctccagcctcgttattattccatctcgtcatcttccctc
gtccagaaggataagatcagtatcaccgccgttgtggaatccgtccgtttgcctggtgcc
tcccaccttgtcaagggtgtgaccacgaattacctccttgcgctcaagcaaaagcagaat
ggtgaaccttctcctgaccctcacggcttgacgtacgctatcactggtccgcgcaacaag
tatgatggcattcacgttcctgttcacgtccgccactcgaatttcaaactgccatccgat
ccctcgagacccattatcatggttggacctggtaccggtgtcgcacctttccgtggcttc
atccaagaacgagccgccttggcggctaaaggcgagaaagtcggcacaactgttttgttc
tttgggtgccgtaatcgcaatgaggatttcttgtatcaggacgaattcaaggcttatgag
gagcaacttggtgattcattgaagatcatcactgcattttcccgcgagacttctcaaaag
gtttatgtccaacatcggttgcgcgaacaagctgagctggtcagcgaccttctgaagcag
aaagccacattctacgtttgtggagatgccgccaacatggcgcgtgaggtcaatctggtg
cttggccagattattgcccaacagcgtggtcttcccgccgagaagggcgaggagatggtc
aagcatatgcgcagcagtggaagctaccaggaggatgtctggtcatga

DBGET integrated database retrieval system