KEGG   Aspergillus flavus: AFLA_110330Help
Entry
AFLA_110330       CDS       T01090                                 

Definition
alkaline phosphatase, putative
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
afv  Aspergillus flavus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:afv00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 499 aa AA seqDB search
MHIRTAITAGAALVQTAVAASVQAKNVIYIVPDGYGPASQNMARDLMSLVDSGTTGSNPK
IDELPVDDLAIGRVRTHSANNMITDSAASGTAYAAGHKSYNGAISVTPDGQPVGSILEAA
KLGGMKTGLVSTTYISDATPGVYAAHAANRGSMPLIAEQQLGYSHPLGPMVDLLLGGGRC
NFSPNSTEGSCRTDDFDLLTYAEEQGFTVATSREEFNALGKGQGQADLPFLGLFSDGNMR
YEMDRRVIQDEPSLLEMAETAVNALHRATRRRNKGFFLMIEAARIDHAGHDNDPANHAFE
TVMYNNVVAWVRDWIDQHPDTIMLSAADHETGGLTLNGYDPLPLRNATHSRAYLQSVWDN
DRPADVDERDFLVSEILPAYGLENVEDADIQTILDADSIGAGIAALMSSRAGVDWSTGGH
TSVDVTLHGYAAGRKRQALKADLAGGWDNTELPRYIEEVLGLDMDAVTERLRKAAEEDSS
WLGPRELARRDLGGCDHYH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcatatccgcactgccatcactgcgggcgcggcccttgtccagactgcagttgcagct
tctgtccaggcaaagaacgttatttatatcgttcccgatggctacgggcctgcgtcgcag
aacatggcccgcgaccttatgtctctggttgatagtggcacgactggcagcaacccgaag
attgatgagcttccagtggacgacctggctatcggacgtgtcagaacccactccgccaac
aacatgatcaccgactcggctgcttctggaaccgcgtatgctgccggacacaagtcctac
aacggtgccatctctgtcacacccgatggccagcctgtaggttccatcctcgaggccgct
aagcttggaggcatgaaaactggtctcgtgtccacgacatacatcagcgatgccaccccc
ggagtctatgcagctcacgccgccaaccgtggatctatgcccctgatcgcagagcaacag
ctcggctatagccatccactcggccccatggtcgatctgcttctcggtggcggacgttgc
aacttctcgccaaacagcacagagggatcctgccgtacggacgatttcgacctactgacc
tacgcagaggagcagggcttcaccgtcgccacgagccgcgaagagttcaatgctcttggg
aagggtcagggtcaggcagatctaccatttctgggtcttttcagcgatggcaacatgcgc
tacgaaatggatcgtcgcgtcatccaggacgaaccttccttgcttgagatggccgagaca
gccgtgaatgctctccaccgcgccactcgtcgccggaacaagggcttcttcctcatgatc
gaggccgcccgaatcgatcacgccgggcacgacaacgacccagccaaccacgccttcgag
actgtcatgtacaacaacgtagtagcctgggtgcgagactggatcgaccaacacccagac
acgatcatgttgtctgccgccgaccacgaaaccggcggcctgaccctgaacggctacgat
ccgctccctctacgcaatgccacccactcgcgtgcctacctccagtccgtctgggacaac
gaccgcccggccgacgtcgacgagcgggacttccttgtctccgagattctccccgcttac
gggctcgagaacgtcgaagacgcggacatccaaaccatcctcgacgcagacagtatcggg
gccggcatcgccgcccttatgtcctctcgcgccggcgttgactggtcgacgggaggccac
acctctgtcgacgtcactctgcatggttatgccgctggtcggaagcgccaggccctgaag
gcggacctcgccggaggttgggataacactgagctccctcgctacattgaagaggttctc
ggtctcgatatggacgccgttaccgagcggctgcgcaaggccgctgaggaagactcgtcg
tggctgggcccgcgcgagctagctcgtcgtgacctcgggggttgcgatcactaccactag

DBGET integrated database retrieval system