KEGG   Aspergillus flavus: AFLA_110810Help
Entry
AFLA_110810       CDS       T01090                                 

Definition
possible apospory-associated protein c
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
afv  Aspergillus flavus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_110810
Enzymes [BR:afv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AFLA_110810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MDRSNKPSAIGVGASVPQPTISLRDNTVEATLPSGESVTIHLYGATVTSWKLANGKEQLF
VSEKAHLDGSKPIRGGIPVVFPVFGPPPQNHATSSLPQHGFARNSTWEFLGKSSSESLGK
DRSGDGSVKLDFGLSRPMLTEDFQKAWPYDFGLVYSVTLTKESLETSLQVQNKGSQNFDF
QVLMHTYLKIDDISDIRVKNLESKTYVDKTQNAAVITETSPAVEINKETDRVYQSLDPKV
PIIVSSASDDKPIFSITREGLNDVVVWNPWIEKAKGMADFGPGEAYKNMICVEAGSVAGW
QTLEAGDFWEGGQSIRPRL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaccgttctaacaagccttcggccatcggcgtgggtgcatctgtgcctcagcccacc
atctccctccgcgacaatactgtcgaagccacgctgccctccggcgaatccgttacgatc
cacctgtacggagctactgtcacttcctggaaattagcaaatggcaaagagcaattattt
gtgagcgagaaggctcatcttgacggttcaaagccaatccgcggcggtatccccgttgtg
ttccctgtcttcggtcctcctcctcagaaccatgccacctcctcccttccacaacacggc
tttgcgcgtaacagtacttgggaattcttgggcaagtcatcatcggaatccctaggcaag
gatcgcagcggagatggctctgtcaagctggacttcggtctctcccgccccatgctcaca
gaagatttccagaaggcatggccgtacgacttcgggctggtatatagcgttactttgacc
aaggagagtctggagacgtctctccaggtgcagaacaagggtagtcagaattttgacttc
caggtattgatgcatacgtatctcaagatcgacgacatctccgatatccgcgtcaagaac
ctcgaatctaagacctacgtcgataaaacacagaatgctgccgtcatcaccgaaacctcc
cctgccgttgagatcaacaaggaaaccgaccgcgtgtaccaatcattggaccccaaggtg
cctattattgtttcgtccgctagtgatgataagcccattttctccattaccagggaggga
ctgaatgacgtcgttgtgtggaacccgtggattgaaaaggccaagggcatggctgacttt
ggtccgggtgaggcatacaagaacatgatctgtgttgaagcaggctccgtggctggatgg
cagactttggaggccggtgacttctgggaaggcggacagtccatccggccgagactgtga

DBGET integrated database retrieval system