KEGG   Aspergillus flavus: AFLA_110960Help
Entry
AFLA_110960       CDS       T01090                                 

Definition
lysophospholipase Plb1
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
afv  Aspergillus flavus
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:afv00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 638 aa AA seqDB search
MKPTTAAIALAGLLSAAPGPHGERIERIDRTVLERALPNAPDGYVPSNVSCPANRPTVRS
ASSGLSSNETSWLKTRREKTQSAMKDFFNHVTIKDFDAVQYLDNHSSNTSNLPNIGIAVS
GGGYRALMNGAGAIKAFDSRTENSTATGQLGGLLQSATYLAGLSGGGWLVGSIYINNFTT
ISALQTHEDGAVWQFQNSIFEGPDGDSIQILDSATYYKHVYDAVQDKKDAGYETSITDYW
GRALSYQLINATDGGPSYTWSSIALTDTFKQADMPMPLLVADGRYPDELVVSSNATVYEF
NPWEFGTFDPTVYGFVPLEYVGSKFDGGSIPDNETCVRGFDNAGFVMGTSSSLFNQFFLQ
VNSTSLPDFLKTAFSDILAKIGEEDEDIAVYAPNPFYNWAPESSPAAHQQELDMVDGGED
LQNIPLHPLIQPERHVDVIFAVDSSADTTYSWPNGTALVATYERSLNSTGIANGTSFPAI
PDQNTFVNNGLNTRPTFFGCNSTNTTGPTPLVVYLPNYPYVSYSNWSTFQPSYEISERDD
TIRNGYDVVTMGNSTRDGNWTTCVGCAILSRSFERTNTQVPDACTQCFQKYCWDGTTNST
NPADYEPVTLLEDSAGSALSPAVITTIVATSAALFTLL
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccacaacagctgcaattgctttagccgggttgctgtctgcggccccaggccct
catggagaaaggattgagaggattgatagaactgtgttggaacgtgcattgccaaatgct
cccgatggatatgtaccgtccaacgtcagttgtcctgcgaatcgcccgacggtgcgtagc
gcatcatccgggctctcgagcaatgagacctcgtggttgaaaacccgacgggagaagact
caatctgccatgaaagatttcttcaaccatgtcacgattaaggactttgatgctgtccaa
tatctcgacaaccactcgagtaacacgtccaatcttcccaatattggtattgcggtgtct
ggtggaggttatcgcgccctgatgaacggtgccggagcgatcaaagcgtttgatagccga
acggagaactcgacggcgacgggacagttgggtggtctgctacagtcggcgacgtatctg
gctggtctgagtggtggtggatggctggtggggtcgatctatatcaacaatttcaccacc
atttcagcactgcagacccatgaggatggtgctgtctggcagtttcaaaactcgattttt
gagggccctgacggcgatagcattcagattctggattctgcgacttactacaagcacgtt
tacgatgcagtgcaagacaagaaggatgcgggatacgaaacctctatcactgattattgg
ggtcgcgctctctcttatcaattgatcaatgctaccgacggcggtccgagctatacttgg
tcgtccattgccctaaccgatacatttaagcaggcagatatgccgatgcctctcctcgtt
gccgacggtcggtatcccgatgagctcgtggtcagcagcaacgctactgtctatgagttt
aacccttgggagtttggtacttttgatccaacagtctacgggtttgtgcctctagaatac
gtaggctctaaattcgacggtggttctatccccgacaacgagacctgtgtacgcggattc
gacaacgccggttttgttatgggtacttcgtcaagtttgttcaaccagttcttcctgcag
gttaactcaacttcgcttcctgatttcctgaagacggcattctcggacatcttggcaaag
attggtgaagaagatgaggacattgctgtctatgcacccaacccgttctacaactgggcc
cccgagagctcaccagcagcccatcaacaggaactcgatatggtggacggtggcgaggat
cttcagaacattcctctgcatcctttgattcagccagagcgtcacgtagatgttatcttt
gctgttgactcctccgctgacacgacttattcttggcccaacggcacagctctcgttgcc
acttacgagcgcagcctgaactccaccggtatcgctaacggaacctcattccccgcgatc
cctgaccagaatacctttgttaacaatggcttgaatacgcggccaacgttcttcggatgt
aacagtacgaacaccacaggccctacgcctttggttgtctaccttccgaactatccatac
gtgtcttactcgaactggtcaaccttccagccaagctatgagatctccgaaagagacgac
accatccgcaacggatatgatgtggtgacgatgggtaacagcactcgtgatggtaactgg
acgacctgcgtcggttgtgctattctgagtcggtctttcgagcgcacgaatacccaggtt
ccggatgcctgcacccagtgcttccagaagtactgctgggatggcactacgaactccacc
aaccctgctgactatgagcccgtcaccctgttggaggatagtgctggttccgctctctcc
ccggctgtcatcaccaccatcgtagcgaccagtgctgctcttttcaccttgctgtga

DBGET integrated database retrieval system