KEGG   Aspergillus flavus: AFLA_111050Help
Entry
AFLA_111050       CDS       T01090                                 

Definition
hypothetical protein
Organism
afv  Aspergillus flavus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 469 aa AA seqDB search
MSPISPVTGPSSEDALRTEKHCVLEKKRPFVDEDSSLSGREPGRPRPVSWHPSTPVEPPL
NSTQLRPIGVDSILNPPAKAPSVSASAETGREGLGDQFSTSPSRQHLLPATVHLPSPSTH
AKRLSTSPGMRSRQIITPVSPSARFVSSGVGYPRKASASQSPLVQETLPGTYTVAPGSPL
PVDSVTGQPMSVSGYQQPVPVSVHSTPTFHSRRTSANPTPNPSPQETSPTTPISTFSQFG
RSSPAATPASGPQPAPSYMHSTPHTKMEPVSRLPSVVAGHKHVSEEPVVLPGSQPENPPY
PGMIPCILDLKSGSSSQAEKRKANSDASRRFRNRKRNELQMEQKITAQQDEIRKQTELLQ
RQAQEIRALMQERDFYRSERDFYREHVSRLAPSGQIPARPASPRSFQPSDRDHQAWPTTD
TTQRVVDPSGVPPPASATRSTGSWTSRGTLADEQQARSLPQFPGPWTRT
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgatttctccagtgacaggcccttcatcagaagatgcccttcgaactgagaag
cactgtgtcctggagaagaaacgccctttcgtagacgaggattcgtctttgagcggccgc
gagcctggacgtccgcggcctgtttcgtggcatccctccacccctgtggagcccccgctg
aattctacccagcttcgtcccattggagtcgactctatcttgaaccccccggcgaaagca
ccatcagtatccgcttctgcggaaactggtcgggaagggttgggagaccagttctcaacc
tccccgtctcgtcaacatctccttcccgcaacagtacatctcccatctccttcaacacac
gcaaagcgcctatcgacatctccaggcatgaggagccgccagatcatcactcccgtttca
ccatcagctcgctttgtcagctctggagtcggttatccacgaaaagcgagtgcttcccag
tctccactagttcaagaaacactcccgggaacatataccgtggcgcctggttcacccttg
cctgtggattcggtaactgggcagccgatgtccgtgtcaggatatcaacagcctgttcca
gtgtccgtgcattccacaccaaccttccatagccgccggacaagtgctaatccgacacca
aacccgagcccccaggagacgagccctacgacacccatctcgacctttagtcagttcgga
cggtcgtctcctgcggctactcctgcttctggcccacagcctgcgccatcatatatgcat
tccactccacatacgaagatggagccagtcagccgactgccttcagtagttgcagggcac
aagcatgtgagtgaagagcccgtcgtcctgcctggctcccagccggaaaatcccccttac
cccgggatgatcccctgcatcctagacctgaaatctggctcgtctagccaggccgagaag
cgaaaggccaatagcgatgcctcgaggaggttccgcaataggaaacgaaacgagctgcag
atggagcagaagatcacggctcagcaggatgaaatccggaagcaaacggaattactgcag
aggcaggcccaagagattcgggccttgatgcaagagcgcgacttttaccgctccgagagg
gacttctaccgcgagcacgtcagccgtctggcgccttccggtcaaatcccggcccggcca
gcctctccacgctcctttcaaccctcggatcgtgaccatcaggcgtggcctactacagac
accacacagcgagttgtggatccaagcggagtgccaccgcccgcatcggcgaccagatca
actggtagctggacaagtcgagggactctagcagacgaacagcaggcaagatcactgcca
cagttccctgggccttggacacgcacttga

DBGET integrated database retrieval system