KEGG   Aspergillus flavus: AFLA_112130Help
Entry
AFLA_112130       CDS       T01090                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
afv  Aspergillus flavus
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:afv00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AFLA_112130
Exosome [BR:afv04147]
 Exosomal proteins
  Proteins found in most exosomes
   AFLA_112130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1762 aa AA seqDB search
MLAKHVLAVLLSVGASAIPFDKRDASAVLADFNTLSTDLSALGSAISSFDGTLNGALGVQ
QKEGQVETALKQTVSDVKASTAFSAADSTSVTNAVTGLEPSIVNVLNDLVSKTLESDHYV
CVRQKLNEEDKPQVIIINLKNNNEILKRPINADSAIMHWTKNIIALKAQGRTIQIFDLGA
KQKLKSAVMNEDVVYWKWFSDKCLGLVTDSSVYHWDVFDPTQSQPLKIFDRLPNLSGCQI
INYRVNDDEKWMVVVGISQQQGRVVGSMQLYSKERGISQFIEGHAAAFASIRVEGSPLEH
KLFTFAVRTQTGAKLQIAEIDHQDPNPRFQKKAVEVYFPQEAVNDFPVAMQVSRKYDVVY
LVTKYGFIHLYDLETGTCIFMNRISSETIFTTAPDSDSAGLVGVNRKGQVLSVSVDENTI
VQYLMENPAMSGLAVRLASKAGLAGADHLYQQQFDNLLAQGNYSEAAKIAANSPRGFLRT
PETINRFKNAPQTGQQMSVILQYFGMLLDKGSLNKYESVELVRPVLQQNRKHLLEKWMRE
EKLEGSEELGDIVRPYDMNLALQIYLQANVPHKVIAGFAETGQFDKILAYSKQVGYQPDY
TQLLQHIVRVNPEKGAEFAAQLANEESGALIDLDRVVDVFLSQNMIQQATSFLLDALKDN
KPEHGHLQTRLLEMNLVNAPQVADAILGNEIFTHYDRPRISQLCENAGLIQRALENTDDP
TAIKRNIVRTDKLSPEWLMNYFGRLSVEQTLDCMDTMLQVNIRQNLQAVVQLATKFSDLL
GPGSLISLFEKYRTAEGLYYYLGSIVNLSEDPEVHFKYIEAATAMGQVTEVERICRESNY
YNPEKVKNFLKEAKLTEQLPLIIVCDRFNFIHDLVLYLYQNQQYKSIEVYVQRVNPSRAP
AVVGGLLDVDCEESIIKNLLSTVDPAVIPIDELVNEVESRNRLKLLLPFLEATLATGNQQ
QAVYNALAKIYIDSNNDPEKFLKENDMYDTLTVGKYCEKRDPNLAYIAYRKGQNDLELIN
ITNENAMYRAQARYLVERADPEIWSFVLSENNVHRRSMVDQVIATAVPESTEPDKVSVAV
KAFLEADLPGELIELLEKIILEPSPFSDNGSLQNLLMLTAAKADKGRLMDYIHQLNEFSP
DEIAEMCISVGLYEEAFEIYKKVNNYIAAVNVLVENIVSIDRAQEFAERVELPDVWSKVA
KAQLDGLRVSDSIESYIRASDPSNYLEVIETATHAGKDEDLVKYLKMARKTLREPPIDTA
LAFAYARLDQLSELEDFLRSTNVADVETSGDKAYEEGYHEAAKIFYTSISNWAKLATTLV
HLEDYQAAVECARKANSVKVWKQVNEACVNKKEFRLAQICGLNLIVHAEELQDLVRQYER
NGYFDELISVLEAGLGLERAHMGMFTELGIALSKYHPDRVMEHLKLFWSRINIPKMIRAC
EDANLWPELVFLYCHYDEWDNAALAMMERAADAWEHHSFKDIIVKVANLEIYYRALNFYL
QEQPLLLTDLLQVLTARIDVNRVVRIFQSSDNIPLIKPFLLNVQTQNKRAVNDAINDLLI
EEEDYKTLRDSVDNYDNFDAVELAQRLEKHELIFFRQIAANIYRNNKRWEKSITLSKQDK
LYKDAIETAALSGKAEVVEELLRYFVDIGSRECYVGMLYACYDLIRPDVIMEVSWRHGLH
DFTMPYMINFLCEQTRTIEMLKKDNEERKKREVTQKTEEDNTPILGGSRLMLTQGPAAPV
PSPMPYQQTNGITPQATGFRPF
NT seq 5289 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccaaacacgtccttgctgtccttctgtctgttggcgcttccgccattcctttc
gacaagcgagatgcatccgctgtcctcgctgattttaacacactctcaaccgacctgtcg
gctctcggctctgctatttcgagcttcgatggaacgctcaatggtgccttgggcgtccag
cagaaggaaggccaagtagagacggcgttgaagcaaaccgtcagcgatgtgaaagcgtct
actgcgttcagtgctgctgacagcacaagcgtgaccaatgctgtgactggtctggagcct
agcattgtgaacgttctcaacgatctcgtttccaagactctagaatcggatcactatgtc
tgcgttcggcaaaagctcaatgaagaagataaacctcaagttatcatcatcaacttaaag
aataacaatgaaatcctcaaacggccaattaacgccgatagtgctatcatgcactggacc
aaaaacatcatcgctttgaaggctcaaggccgcacaatccaaatcttcgatcttggggcg
aaacagaagctgaagtcagcggtgatgaatgaggatgttgtttactggaagtggttcagc
gacaagtgcctgggtctggtaacggactcgtccgtttaccactgggatgtcttcgaccct
acacagtctcagccactcaagatcttcgaccgactccctaacttgagcgggtgccaaatt
atcaactatcgcgttaacgatgatgagaaatggatggtagtagttggaatcagccagcag
caggggcgtgttgtgggctcgatgcagctgtactctaaggaacgtgggatctcgcaattc
atcgaaggacatgctgccgccttcgcttcgattcgagtcgagggttctcctttggaacat
aagctcttcacctttgccgttcggacccagaccggtgccaagttacagatcgccgagatt
gaccaccaagatccgaacccccgattccagaagaaggctgtcgaggtgtatttccctcaa
gaggctgtcaatgatttcccggtggcgatgcaagtatctcggaagtacgatgtcgtgtat
cttgtcaccaagtatggcttcattcatctctatgatctcgagactggcacctgcattttc
atgaaccggatctccagcgagaccattttcactaccgcgcccgactcagattcggctggc
ttggttggtgtgaaccgcaagggtcaggttctgtccgtcagcgttgatgagaacacgatt
gttcagtacttgatggagaaccctgctatgtctgggcttgcagtgaggcttgcctccaag
gctggacttgccggtgcggaccatctctaccagcaacagtttgacaacctccttgcccag
ggcaactactctgaggctgctaagatcgccgcaaactcgccccgcggattccttcgcact
ccggaaaccatcaaccgcttcaagaatgctcctcaaaccgggcagcaaatgtctgttatc
ctccagtactttggaatgcttttggacaagggatctctgaacaaatacgagagtgttgag
ctcgtccgccccgtcttgcagcaaaaccggaagcacctccttgagaagtggatgcgtgaa
gaaaagctggagggctccgaggaacttggagatattgttcgaccctatgacatgaacctt
gctctgcagatttacttgcaagccaatgttcctcacaaggtcatcgctggctttgcagag
actgggcaattcgataagattctcgcgtactccaagcaggtcggttatcagcctgactat
acccagctgttgcagcatattgtgcgtgtgaaccctgagaagggtgccgaatttgctgct
cagctcgccaacgaggaatctggtgcactgatcgacctggatcgtgttgtggacgtattc
ttgtctcagaacatgatccagcaggcgacttctttcttgttggatgccctcaaggataac
aagcctgagcatggtcatctgcagacacggttacttgagatgaacctggtcaacgcccct
caagtggctgatgctatccttggcaacgagatcttcacccactacgatcgcccaagaatt
tcccagctgtgcgagaatgctggcctcatccaacgcgccctggagaacactgatgatcct
acagccatcaagcgtaacatcgtccgcaccgacaagctgagccctgaatggttgatgaat
tacttcggtcgtctttctgttgagcagactctcgactgcatggatacgatgttgcaggtg
aacatccgtcagaatttgcaagccgtcgttcagcttgccaccaagttctccgatctcctg
ggtcctggtagcctcatcagccttttcgagaagtaccgtactgctgaaggtctttactac
taccttggaagcatcgttaaccttagcgaggaccccgaggttcacttcaagtacatcgaa
gctgctactgccatgggccaggtcactgaggttgagcgtatttgccgtgagagcaactac
tacaaccccgaaaaggtgaagaacttcctaaaggaggccaagttgacggaacagctccca
ctgatcattgtctgcgatcgattcaactttatccacgacctcgttctctatctctaccag
aaccagcagtacaagtctattgaggtctacgtacagcgtgtcaacccttcccgtgctccg
gcagtggttggagggttactggacgttgattgcgaagagagcattatcaagaaccttctc
tctacggtagatccagccgttatcccgattgatgagcttgtcaacgaggtggagagtcgg
aataggctcaagctgctcttgcctttcctcgaggctactctcgccaccggtaatcagcaa
caggctgtgtacaatgctcttgcgaagatctatatcgatagcaataacgaccccgagaag
ttcctcaaggagaacgatatgtatgacacactgactgtcggcaagtactgtgagaagcgc
gacccgaacctggcctatatcgcgtataggaaaggtcaaaatgacttggagctcatcaac
atcaccaacgagaacgccatgtatcgtgcccaggcacgctacctcgttgagagggctgat
ccggaaatctggtccttcgtcttgagtgaaaacaatgttcaccgtaggtccatggttgac
caggtcatcgcaactgcagtgcctgaatcgacggaacctgacaaggtgtctgttgctgtt
aaggccttccttgaagccgacctgcctggcgagcttatcgagctgctagagaagattatc
cttgagccatcacctttcagtgacaatggcagcttgcagaacctgcttatgctcaccgct
gccaaggctgacaagggccgcctgatggactatattcatcagctcaacgaattcagccct
gatgaaattgcggaaatgtgtatctcggttggcttgtatgaggaggctttcgaaatttac
aagaaggtcaacaactacattgccgccgtcaatgtccttgttgagaacattgttagcatt
gatcgtgcccaagagtttgctgagcgtgttgagttgccggatgtatggagcaaggttgcc
aaggcacaactagacggtcttcgtgtgtctgactcgatcgagtcgtacatccgtgctagt
gacccttcgaactaccttgaggtcattgaaaccgcaacccacgctggcaaggatgaggat
ctcgttaagtatctcaagatggcacgcaagactttgcgggagccccctattgacactgct
ttggccttcgcctacgccagactcgatcaactctcagaacttgaggacttcttgcggtcg
accaatgttgcggatgttgagacatctggtgacaaggcctacgaggaaggctaccatgaa
gctgccaagatcttctacactagcatctcgaactgggccaagcttgccacaaccttggta
cacttggaagactaccaagctgcggtggaatgtgcccgcaaggccaacagtgtcaaggtc
tggaagcaggtcaacgaagcatgcgtcaacaagaaggagttccgtcttgcccagatctgt
ggtctcaatctcatcgtccatgctgaggagctgcaggatcttgttcgccaatacgaacgc
aacggttacttcgatgaacttatctctgttctggaggctggcttgggcttggagagggcc
cacatgggtatgttcactgagttgggtattgcgctctccaagtaccaccctgatcgggtc
atggagcacctcaaactcttctggtcccgtatcaatatccccaagatgatccgggcttgc
gaggatgccaacctctggccagagctggtgttcttgtactgccactatgatgagtgggat
aacgccgcattggcaatgatggagcgtgctgccgacgcttgggaacatcactcattcaag
gatatcatcgtcaaggtcgctaatcttgagatttactatcgtgctctcaacttctacctg
caagagcagcctttgcttcttaccgatctgctccaggttttgaccgccaggattgacgtc
aatcgtgttgttcgcattttccagtcctcagataacatacccttgatcaagcccttcctc
ctgaacgtccagacccaaaacaagagggcagtgaatgatgccatcaatgacctcttgatc
gaggaggaagattacaagaccctgcgcgactcagtggacaactacgataacttcgacgcc
gtggaactggctcagcgtctggagaagcacgaactgatcttcttccgtcagattgctgcg
aacatctaccgcaataataagcgttgggagaagtcgattacactttcgaagcaggacaag
ctctacaaggatgcaattgagaccgcggcgctctcgggcaaggctgaggtggtggaggag
ctccttcgctactttgtggacattggcagcagggaatgctacgttggtatgctgtatgcc
tgctacgaccttatccgtcccgatgtgatcatggaggtctcgtggcgccacggccttcac
gatttcaccatgccctacatgatcaacttcctgtgcgagcagacgcgtacgatcgagatg
ctcaagaaggacaacgaggagcgcaagaagcgcgaagtcacacagaagaccgaagaggac
aacacaccgatcctgggtggctcgcggctgatgttgacccagggtccagcggcgcccgtg
ccaagtcctatgccgtatcaacagaccaacgggatcacgccgcaggccaccggcttccgc
ccgttctag

DBGET integrated database retrieval system